DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpina5

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_766541.2 Gene:Serpina5 / 268591 MGIID:107817 Length:405 Species:Mus musculus


Alignment Length:371 Identity:108/371 - (29%)
Similarity:182/371 - (49%) Gaps:24/371 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAE- 74
            :.||..|:..|...|.|.|:.:||||:.:|..||.:|.  |..|..::.:||   ||..||..| 
Mouse    44 KDFAFRLYRALVSESPGQNVFFSPLSVSMSLGMLSLGA--GLKTKTQILDGL---GLSLQQGQED 103

  Fly    75 ----SFGVVLKSYEQCQ---VLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS-EQAAS 131
                .|..:|:.:.|..   .|.:.:.|:....:.:.:.|...::..:.|.....:||: |.|..
Mouse   104 KLHKGFQQLLQRFRQPSDGLQLSLGSALFKDPAVHIRDDFLSAMKTLYMSDTFSTNFGNPEIAKK 168

  Fly   132 IINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGS-DRPTRV 195
            .||.:|..||...|.|.|  :.|.....:.:||.|.||.:|..:|:|..|.:.||..: .|.|:|
Mouse   169 QINNYVAKQTKGKIVDFI--KDLDSTHVMIVVNYIFFKAKWQTAFSETNTHKMDFHVTPKRTTQV 231

  Fly   196 RMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNL 260
            .||:..:.:.:.:......|.:.:.|.. |...:.:||.| ..:..:|..|.:.:|.........
Mouse   232 PMMNREDGYSYYLDQNISCTVVGIPYQG-NAIALFILPSE-GKMKQVEDGLDERTLRNWLKMFTK 294

  Fly   261 EKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGT 325
            .::|:.:|.|:.|...:|..||..:|:..:|:..|:|.| :....::.:|::|||:.:|:.|.||
Mouse   295 RRLDLYLPKFSIEATYKLENVLPKLGIQDVFTTHADLSG-ITDHTNIKLSEMVHKSMMEVEESGT 358

  Fly   326 EAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDNTHGLLFAG 371
            .|||.|.|:.||||  ||....|: ...|||...:.:::| :||.|
Mouse   359 TAAAITGAIFTFRS--ARPSSLKI-EFTRPFLLTLMEDSH-ILFVG 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 108/370 (29%)
Serpina5NP_766541.2 serpinA5_PCI 42..405 CDD:381021 108/371 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.