DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb10

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_714955.2 Gene:Serpinb10 / 266775 RGDID:628853 Length:397 Species:Rattus norvegicus


Alignment Length:401 Identity:119/401 - (29%)
Similarity:194/401 - (48%) Gaps:45/401 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLE--- 68
            |..:.|||:.....|..::.|.||.:||..|..|.||:.:||.  ..||.:|.:.|.||.::   
  Rat     5 AVSINQFAVEFSKKLAESAEGRNIFFSPWGISTSLAMVYLGTK--GTTAAQMSQVLHFGSIQDFK 67

  Fly    69 -----------------AQQVAESF----GVVLK---SYEQCQVLKMANGLYVMKGLQVDEQFGH 109
                             ::::...|    ..:||   ||    |||:||.:||.|......::..
  Rat    68 FGPDSEKKRKMECHSGKSEEIQSDFQTLTAKILKHGNSY----VLKIANRIYVEKTYLFHNKYLE 128

  Fly   110 ILEQKFRSKPMEIDF--GSEQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEW 172
            .::..|.::|..::|  .|.|....||.||.|||...|.:::....:...:.:.|||.::|||.|
  Rat   129 DMKTYFGAEPQSVNFVEASGQIRKEINSWVGSQTGGKIPNLLPDDAVDNKTTMVLVNALYFKGTW 193

  Fly   173 SISFNEKETREEDF-FGSDRPTRVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEK 236
            ...|:.:.|.|..| ........|:||.:.::.....:...:...::::|.....::::|||:|.
  Rat   194 EHQFSVQNTTERPFRINKTTSKPVQMMSMKQSLQVFHIEELQTIGVQLHYQNREFSLLLLLPEEV 258

  Fly   237 SNLTSLEKKLSDISLEVVSSA--MNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFS-GQAELG 298
            ..|..||:.::...|:..:||  |:..:|.:.:|.|..|...:|...|..|||...|: |:|...
  Rat   259 EGLKQLERAITYEKLDKWTSADMMDTYEVQLYLPKFKMEESYDLQSALRDMGMTDAFNQGKANFS 323

  Fly   299 GMLQSEESLFVSQIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN 363
            .| .||.:||:|.:.||.|:||||.||||||.|.:...||.    :.|....:|:.||.:.|:.|
  Rat   324 NM-TSERNLFLSNVFHKTFLEINEEGTEAAAGTGSEVNFRI----KAPSIELNADHPFLFLIRHN 383

  Fly   364 -THGLLFAGHF 373
             |:.:||.|.|
  Rat   384 VTNTILFYGRF 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 117/394 (30%)
Serpinb10NP_714955.2 SERPIN 4..397 CDD:294093 119/401 (30%)
Nuclear localization signal. /evidence=ECO:0000250 74..77 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.