DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb10

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:283 Identity:71/283 - (25%)
Similarity:129/283 - (45%) Gaps:42/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 MLRMGTSEGSATAKEMDEGLRFGGLE--------------------AQQVAESF----GVVLK-- 81
            |:.:||.  ..||.:|.:.|:|..:|                    .:::...|    ..:||  
Mouse     1 MVYLGTK--GTTADQMAQVLQFSSVEDFKSCPDSEKKRKMEFNSGKFEEIQSDFQTLAAEILKPG 63

  Fly    82 -SYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--GSEQAASIINKWVESQTNN 143
             ||    |||.||.:|..|......::...::..|.::|..::|  .|.|....||.||.|||..
Mouse    64 NSY----VLKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQSVNFVEASGQIRKEINSWVGSQTGG 124

  Fly   144 LIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPTR-VRMMHVCENFFFA 207
            .|.:::....:...:::.|||.::|||.|...|:.|.|.|..|..:...:: |:||.:.::....
Mouse   125 KIPNLLPDDSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPFRVNKTTSKPVQMMSMKQSLQVF 189

  Fly   208 VLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSA--MNLEKVDVKIPSF 270
            .:...:...|:::|...:|::::|||:....|..||:.::...|:..:||  |:..:|.:.:|.|
Mouse   190 HIEELQTIGLQLHYQNRDLSLLLLLPEAIDGLEQLERAITYEKLDKWTSADMMDTYEVQLYLPKF 254

  Fly   271 TAEFQQELSQVLMLMGMNRIFSG 293
            ..|...:|...|    ..:.|||
Mouse   255 KMEESYDLKSAL----RGQKFSG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 71/283 (25%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 71/283 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.