DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpina3j

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001094942.1 Gene:Serpina3j / 238395 MGIID:2182843 Length:420 Species:Mus musculus


Alignment Length:365 Identity:104/365 - (28%)
Similarity:179/365 - (49%) Gaps:35/365 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQ--VAES 75
            ||..|:..|...:...|.::|||||.|:.|.|.:| ::|: |.:|:.|||:|...|..:  :.:.
Mouse    54 FAFSLYKKLALKNPHKNFVFSPLSITIALASLSLG-AKGN-TLEEILEGLKFNLTETPEADIHQG 116

  Fly    76 FGVVLKSYEQ--CQV-LKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS-EQAASIINKW 136
            ||.:|:...|  .|| :...|.:.|.|.||:..:|.......:.::....||.. .:|..::|.:
Mouse   117 FGHLLQRLSQPGDQVQISTGNSMVVEKHLQILAEFKEKARALYHTEVFTADFQQPREARKLLNDY 181

  Fly   137 VESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGS---DR--PTRVR 196
            |.:||..:||:::..  |.:.:.:.:.|...|.|:|:::|:..||    |.|:   ||  |.:|.
Mouse   182 VSNQTQGMIKELVSD--LEERTSMVMTNFALFNGKWNMTFDPYET----FMGTFIEDRRTPVKVS 240

  Fly   197 MMHVCENFFFAVLPMF-----EATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSS 256
            ||.:.|    ...|.|     :.|.:.:||.....||.| |||: ..:..:|..|...:|.....
Mouse   241 MMKMKE----LRAPYFRDEKMKCTVVELNYKGNGKAMFI-LPDQ-GKMKQVEASLQPATLRGWRK 299

  Fly   257 AMNLEKVD-VKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEI 320
            ::....:| :.:|.|:......|..:|..:|:..:||.||:|.| :...:.:.||::.|.|.:::
Mouse   300 SLRPRMIDELYLPKFSISKNYRLENILPELGIKEVFSTQADLSG-ISGGKDVRVSRMFHSAALDM 363

  Fly   321 NEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAI 360
            .|.||||.|.|.....|.|..:.   |.|.:.|.||.:.:
Mouse   364 TETGTEARATTRDKYDFLSTKSN---PTVVNLNTPFLFCV 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 104/365 (28%)
Serpina3jNP_001094942.1 serpinA3_A1AC 37..417 CDD:381019 104/365 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.