DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb6a

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001157589.1 Gene:Serpinb6a / 20719 MGIID:103123 Length:399 Species:Mus musculus


Alignment Length:359 Identity:122/359 - (33%)
Similarity:191/359 - (53%) Gaps:23/359 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRF------GGLEAQQVAESFGVVLKSYEQCQ 87
            |:..||:||..:.||:.||..  ..||.:|.:.|..      ||.:..|..:|....:.......
Mouse    47 NVFLSPMSISSALAMVFMGAK--GTTASQMAQALALDKCSGNGGGDVHQGFQSLLTEVNKTGTQY 109

  Fly    88 VLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--GSEQAASIINKWVESQTNNLIKDIIG 150
            :|:.||.|:..|...:...|.....:.:.::..|:||  .:|::...||.||..:|.:.||:::.
Mouse   110 LLRTANRLFGDKTCDLLASFKDSCLKFYEAELEELDFQGATEESRQHINTWVAKKTEDKIKEVLS 174

  Fly   151 PRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGS---DRPTRVRMMHVCENFFFAVLPMF 212
            |..:..|:.|.|||.|:|||.|...||::.|||..|..|   ::|  |:||.....|....:...
Mouse   175 PGTVNSDTSLVLVNAIYFKGNWEKQFNKEHTREMPFKVSKNEEKP--VQMMFKKSTFKMTYIGEI 237

  Fly   213 EATALRMNYSACNLAMIILLPDEKSNLTSLEKKLS-DISLEVVS-SAMNLEKVDVKIPSFTAEFQ 275
            ....|.:.|.:..|.|||:||||...|:::||::: :..:|... ..|:.|:|:|.:|.|..|..
Mouse   238 FTKILLLPYVSSELNMIIMLPDEHVELSTVEKEVTYEKFIEWTRLDKMDEEEVEVFLPKFKLEEN 302

  Fly   276 QELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAATAAVATFRSM 340
            ..::..|..:||...|.|:|:..|| .|::.||:|::|||||:|:||.|||||||||.:.|.|.|
Mouse   303 YNMNDALYKLGMTDAFGGRADFSGM-SSKQGLFLSKVVHKAFVEVNEEGTEAAAATAGMMTVRCM 366

  Fly   341 PARQGPPKVFHANRPFFYAIKD-NTHGLLFAGHF 373
               :..|: |.|:.||.:.|.. .|:|:||.|.|
Mouse   367 ---RFTPR-FCADHPFLFFIHHVKTNGILFCGRF 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 121/357 (34%)
Serpinb6aNP_001157589.1 SERPIN 25..399 CDD:294093 122/359 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.