DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpina3n

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus


Alignment Length:363 Identity:111/363 - (30%)
Similarity:189/363 - (52%) Gaps:27/363 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQ--VAES 75
            ||..|:..|...:...||::|||||..:.|::.:| ::|: |.:|:.|||:|...|..:  :.:.
Mouse    54 FAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLG-AKGN-TLEEILEGLKFNLTETSEADIHQG 116

  Fly    76 FGVVLKSYEQ--CQV-LKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS-EQAASIINKW 136
            ||.:|:...|  .|| :...:.|::.|..|:..:|.......::::....||.. .||..:||.:
Mouse   117 FGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKARALYQAEAFTADFQQPRQAKKLINDY 181

  Fly   137 VESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFF-GSDRPTRVRMMHV 200
            |..||..:||:::..  |.|.:.:.|||.|:||.:|.:.|:..:|.:.:|: |..||..|.||.:
Mouse   182 VRKQTQGMIKELVSD--LDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSM 244

  Fly   201 CENFFFAVLPMFE-----ATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNL 260
            .:    ...|.|.     .|.:.:.|:. |.:.:.:|||: ..:..:|..|...:|....:::..
Mouse   245 ED----LTTPYFRDEELFCTVVELKYTG-NASAMFILPDQ-GKMQQVEASLQPETLRKWKNSLKP 303

  Fly   261 EKVD-VKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVG 324
            ..:| :.:|.|:......|..||..:|:..:||.||:|..:..::: |.|||:||||.:::.|.|
Mouse   304 RMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKD-LRVSQVVHKAVLDVAETG 367

  Fly   325 TEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKD 362
            |||||||.  ..|..|.|:..|..|:. ||||...|.|
Mouse   368 TEAAAATG--VKFVPMSAKLYPLTVYF-NRPFLIMIFD 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 111/363 (31%)
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 111/363 (31%)
RCL 367..392 13/26 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.