DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpina3g

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_033277.2 Gene:Serpina3g / 20715 MGIID:105046 Length:440 Species:Mus musculus


Alignment Length:389 Identity:111/389 - (28%)
Similarity:186/389 - (47%) Gaps:40/389 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQ--VAES 75
            ||..|:..|...:...|:::||.||..:.|:|.:|..  |.|.||:.|||:|...|..:  :.:.
Mouse    44 FAFSLYRKLVLKNPDENVVFSPFSICTALALLSLGAK--SNTLKEILEGLKFNLTETPEPDIHQG 106

  Fly    76 FGVVLKSYEQ--CQV-LKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSE-QAASIINKW 136
            |..:|....|  .|| :...:.|::.|.||:..:|.......::::....||... :|..:||.:
Mouse   107 FRYLLDLLSQPGNQVQISTGSALFIEKHLQILAEFKEKARALYQAEAFTADFQQPLKATKLINDY 171

  Fly   137 VESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFF-GSDRPTRVRMMHV 200
            |.:.|...||.:|..  |.:...:.|||.|:|||:|...|:..:|.:.:|: ...|...|.||..
Mouse   172 VSNHTQGKIKQLISG--LKESMLMVLVNYIYFKGKWKNPFDPNDTFKSEFYLDEKRSVIVSMMKT 234

  Fly   201 CENFFFAVLPMF-----EATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNL 260
                .:...|.|     ..|.:.:.|:. |.:.:.:|||: ..:..:|..|...:|....:::..
Mouse   235 ----GYLTTPYFRDEELSCTVVELKYTG-NASAMFILPDQ-GRMQQVEASLQPETLRKWKNSLKP 293

  Fly   261 EKV-DVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVG 324
            ..: ::::|.|:......|..:|..:|:..:||.||:|..:..::: |.|||:||||.:::.|.|
Mouse   294 RMIHELRLPKFSISTDYSLEHILPELGIREVFSTQADLSAITGTKD-LRVSQVVHKAVLDVAEKG 357

  Fly   325 TEAAAAT-----AAVATFRSMPARQGPPKVFHANRPFFYAIKD-NTHGLLFAGHFITTKVEQSE 382
            |||||||     ...|.|..:       ::|. ||||...|.| ..|..||...  .|..|:||
Mouse   358 TEAAAATGMAGVGCCAVFDFL-------EIFF-NRPFLMIISDTKAHIALFMAK--VTNPERSE 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 107/378 (28%)
Serpina3gNP_033277.2 SERPIN 46..407 CDD:214513 106/381 (28%)
RCL 357..382 10/31 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.