DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb9e

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_035586.1 Gene:Serpinb9e / 20710 MGIID:894672 Length:377 Species:Mus musculus


Alignment Length:373 Identity:114/373 - (30%)
Similarity:196/373 - (52%) Gaps:21/373 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAESFG 77
            ||:.|...||:.:...|:.|||:||..:.||:.:| ::|. ||.::.:.|...  ..:.|.:.|.
Mouse    11 FAIHLLKVLCQDNPSENVCYSPMSISSALAMVLLG-AKGD-TAVQICQALHLN--PDEDVHQGFQ 71

  Fly    78 VVL----KSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--GSEQAASIINKW 136
            ::|    |...|...|.|||.|:|....::...|.....:.:.|:..::.|  .:|::...||.|
Mouse    72 LLLHNLNKPNNQKYCLTMANRLFVENTCELLPTFKKSCLKFYHSEIEQLSFAEAAEESRQHINMW 136

  Fly   137 VESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPTR-VRMMHV 200
            |..||...|.|::....:...:||.|.|.::|:|.|...|.:..|:|..|..:.:.|| |:||..
Mouse   137 VSKQTKGKIPDLLSEDSVDSQTRLILANALYFQGTWCKFFEKDSTKEVPFKINKKETRPVQMMWQ 201

  Fly   201 CENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSA--MNLEKV 263
            .:.||.|.:...:|..|.|.|...:|..::||||:..:::.:|..|:...|...:..  ||..::
Mouse   202 EDTFFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDQGVDISKVENNLTFEKLTAWTKPEFMNRTEL 266

  Fly   264 DVKIPSFTAEFQQELSQVLMLMGMNRIFSG-QAELGGMLQSEESLFVSQIVHKAFIEINEVGTEA 327
            .|.:|.|..:...:::.:|..:|:..:|:| :|:..|| .::|:|.:|:.|||..:|:||.||||
Mouse   267 HVYLPKFKLQEDYDMNSLLQHLGILDVFNGSKADFSGM-STKENLCLSKFVHKCVVEVNEEGTEA 330

  Fly   328 AAATAA-VATFRSMPARQGPPKVFHANRPF-FYAIKDNTHGLLFAGHF 373
            .||:|. :..|...|    .|:||.|:.|| |:.:...|:.:||.|.|
Mouse   331 VAASAGKIILFCDGP----DPEVFCADHPFLFFIMHSTTNSILFCGRF 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 113/371 (30%)
Serpinb9eNP_035586.1 SERPIN 4..377 CDD:294093 114/373 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.