DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb9b

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_035582.1 Gene:Serpinb9b / 20706 MGIID:894668 Length:377 Species:Mus musculus


Alignment Length:376 Identity:113/376 - (30%)
Similarity:199/376 - (52%) Gaps:27/376 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQ-VAESF 76
            ||:.|...||:::...|:.:||:||..:.||:.:|..|  .||.::.:.|   ||:.:: :.:.|
Mouse    11 FAIHLLKMLCQSNPSKNVCFSPVSISSALAMVLLGAKE--QTAVQISQAL---GLKKEKGIHQGF 70

  Fly    77 GVVLKSY---EQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--GSEQAASIINKW 136
            ..:|:..   ::...|.:||.|:..|..:|.:.|.....:.:.|:..:::|  .:.::...||.|
Mouse    71 LKLLRKLNKPDRKYSLIVANRLFADKTCEVLQTFKESCFRFYDSEMEQVNFFKAAVESRQCINTW 135

  Fly   137 VESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFF-GSDRPTRVRMMHV 200
            |..||...|.:::....:...:||.|||.::|||.|:..|.::.|||..|: ..|....|:||..
Mouse   136 VSKQTEGKIPELLADDSVNFQTRLVLVNALYFKGMWACQFCKESTREMPFYINKDEKRPVQMMCQ 200

  Fly   201 CENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVV-----SSAMNL 260
            .:.|.||.:....|..|.|.|....|::::|||::..:|:.:|   :|::.|.:     ...|..
Mouse   201 TDTFMFAFVDELPARLLIMPYEGMELSLMVLLPEKGVDLSKVE---NDLTFEKLIAWTKPDIMWS 262

  Fly   261 EKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQ-AELGGMLQSEESLFVSQIVHKAFIEINEVG 324
            .:|.|.:|.|..:...|:..||..:|:..:|..: |:|..| ..|.:|.:|:.:||:.:|:||.|
Mouse   263 TEVKVFLPKFKLQEDYEMKSVLQCLGIVDVFEKEKADLSAM-SPERNLCLSKFIHKSVVEVNEEG 326

  Fly   325 TEAAAATAAVATFRSMP-ARQGPPKVFHANRPFFYAIKDN-THGLLFAGHF 373
            ||||||::|...   :| ...|.|..|.|:.||.:.|:.| |:.:||.|.|
Mouse   327 TEAAAASSAEGI---IPLCLGGGPSWFCADHPFLFFIRHNQTNSILFCGRF 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 112/374 (30%)
Serpinb9bNP_035582.1 SERPIN 4..377 CDD:294093 113/376 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.