DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpina1e

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_033273.1 Gene:Serpina1e / 20704 MGIID:891967 Length:413 Species:Mus musculus


Alignment Length:397 Identity:121/397 - (30%)
Similarity:197/397 - (49%) Gaps:47/397 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KDE-----EFAQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEG 61
            ||:     |.|..|..||:.|:..|...|...||.:||:||..:.|||.:| |:|. |..::.||
Mouse    35 KDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLG-SKGD-THTQILEG 97

  Fly    62 LRFGGLEAQQ--VAESFGVVLKSYEQCQ---VLKMANGLYVMKGLQVDEQFGHILEQKFRSKPME 121
            |:|...:..:  :..||..:|::..:..   .|...|||:|...|::.|:|....:..::::...
Mouse    98 LQFNLTQTSEADIHNSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFS 162

  Fly   122 IDFG-SEQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREED 185
            ::|. ||:|..:||.:||..|...|.:.:  :.|.:|:...|.|.|.|||:|...|:.:.|::.:
Mouse   163 VNFAESEEAKKVINDFVEKGTQGKIVEAV--KKLEQDTVFVLANYILFKGKWKKPFDPENTKQAE 225

  Fly   186 FFGSDRPT-RVRMM--------HVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTS 241
            |...:..| :|.||        |.|..        ..:..|.|:| |.|...:.||||: ..:..
Mouse   226 FHVDESTTVKVPMMTLSGMLDVHHCST--------LSSWVLLMDY-AGNATAVFLLPDD-GKMQH 280

  Fly   242 LEKKLSDISLEVVSS-AMNLEK--VDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQS 303
            ||:.|:.   |::|. .:|..:  ..:.||..:......|..::..:|:.|||:..|:|.|:.:.
Mouse   281 LEQTLNK---ELISKFLLNRRRRLAQIHIPRLSISGNYNLETLMSPLGITRIFNSGADLSGITEE 342

  Fly   304 EESLFVSQIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAI-KDNTHGL 367
            ...|.:||.||||.:.|:|.||||||||.....|.||      |.:.|.||||.:.| ::::...
Mouse   343 NAPLKLSQAVHKAVLTIDETGTEAAAATVLQGGFLSM------PPILHFNRPFLFIIFEEHSQSP 401

  Fly   368 LFAGHFI 374
            ||.|..:
Mouse   402 LFVGKVV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 116/379 (31%)
Serpina1eNP_033273.1 SERPIN 53..410 CDD:214513 114/379 (30%)
RCL 368..387 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.