DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb3a

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_033152.3 Gene:Serpinb3a / 20248 MGIID:3573933 Length:387 Species:Mus musculus


Alignment Length:390 Identity:127/390 - (32%)
Similarity:207/390 - (53%) Gaps:35/390 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FAQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGL--- 67
            ||:...:|.|.|:..| |.|.. ||.|||:|:..:.|||::| ::|: |.|::::.|:|...   
Mouse     4 FAEATTKFTLELYRQL-RESDN-NIFYSPISMMTALAMLQLG-AKGN-TEKQIEKVLQFNETTKK 64

  Fly    68 ---------EAQQVAESFGVV---LKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPM 120
                     :.:.|.|.|..:   |........||.||.:|..||....:.|...:::.:::...
Mouse    65 TTEKSAHCHDEENVHEQFQKLMTQLNKSNDAYDLKAANSIYGAKGFPFVQTFLEDIKEYYQANVE 129

  Fly   121 EIDF--GSEQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETRE 183
            .:||  .:|::...||.|||||||..|||:.....|.:.:.:.|||.::|||:|:..|:||.|.|
Mouse   130 SLDFEHAAEESEKKINSWVESQTNGKIKDLFPNGSLNRSTIMVLVNAVYFKGQWNHKFDEKHTTE 194

  Fly   184 EDFF---GSDRPTRVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKK 245
            |.|:   .:.:|.::...::..||.|  |...:|..:.:.|....|:||:|||.|.:.|..||::
Mouse   195 EKFWLNKNTSKPVQMMKQNIEFNFMF--LEDVQAKIVEIPYKGKELSMIVLLPVEINGLKQLEEQ 257

  Fly   246 L-SDISLE-VVSSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQ-AELGGMLQSEESL 307
            | :|..|| ..:..|::.::.:.:|.|..:.:.:|...|..|||...|..| |:..|| .|.:.|
Mouse   258 LTADKLLEWTRAENMHMTELYLSLPRFKVDEKYDLPIPLEHMGMVDAFDPQKADFSGM-SSTQGL 321

  Fly   308 FVSQIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPF-FYAIKDNTHGLLFAG 371
            .||:::||:|:|:||.||||||||....:..|....:.    |..:.|| |:.|...|:.:||.|
Mouse   322 VVSKVLHKSFVEVNEEGTEAAAATGVEVSLTSAQIAED----FCCDHPFLFFIIHRKTNSILFFG 382

  Fly   372  371
            Mouse   383  382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 125/384 (33%)
Serpinb3aNP_033152.3 SERPIN 5..387 CDD:294093 126/389 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.