DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINB1

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_109591.1 Gene:SERPINB1 / 1992 HGNCID:3311 Length:379 Species:Homo sapiens


Alignment Length:383 Identity:125/383 - (32%)
Similarity:198/383 - (51%) Gaps:21/383 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EEFAQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGL- 67
            |:.:....:|||.|...|...:...||..||.||..:.||:.:|| .|: ||.::.:...|..: 
Human     2 EQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGT-RGN-TAAQLSKTFHFNTVE 64

  Fly    68 EAQQVAESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--GSEQAA 130
            |.....:|....:.......:||:||.||..|......:|....::.:.:....:||  .||.|.
Human    65 EVHSRFQSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDAR 129

  Fly   131 SIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDF--FGSDRPT 193
            ..||:||:.||...|.:::...::...::|.|||.|:|||.|...|.::.|....|  ...||.|
Human   130 KTINQWVKGQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKT 194

  Fly   194 RVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLP----DEKSNLTSLEKKLSDISLEVV 254
             |:||:..:.|.:..:...:...|.:.|....|:|:||||    ||.:.|..:|::|:...|...
Human   195 -VKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEW 258

  Fly   255 SSAMNLE--KVDVKIPSFTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQSEESLFVSQIVHKA 316
            :...||:  :|:|.:|.|..|....|:..|..:|:..:| |.:|:|.|| .....:|:|:||||:
Human   259 TKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGM-SGARDIFISKIVHKS 322

  Fly   317 FIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDNTHG-LLFAGHF 373
            |:|:||.|||||||||.:|||..:.    |.:.|.|:.||.:.|:.|:.| :||.|.|
Human   323 FVEVNEEGTEAAAATAGIATFCMLM----PEENFTADHPFLFFIRHNSSGSILFLGRF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 123/373 (33%)
SERPINB1NP_109591.1 SERPIN 4..379 CDD:294093 124/381 (33%)
CARD-binding motif (CBM). /evidence=ECO:0000269|PubMed:30692621 351..379 11/26 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.