DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpina16

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_112098.3 Gene:Serpina16 / 194604 MGIID:2684892 Length:440 Species:Mus musculus


Alignment Length:378 Identity:92/378 - (24%)
Similarity:166/378 - (43%) Gaps:25/378 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRF---GGLEAQQV 72
            ::|||.|:..|.::..|.|:|:|||||.:...:|..  .:.....:::.:||.|   |.|:| :.
Mouse    70 QKFALSLYTQLPKSKLGKNVIFSPLSITMPLVLLAF--QDKPEARRQVLQGLGFGVTGALDA-KA 131

  Fly    73 AESFGVVLKSY---EQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQ-AASII 133
            |..:|.:|.:.   |.|.: ...:..::.|.|:....|..:....:.|..:.|.||:.: |...|
Mouse   132 AVQYGKLLSALLPAEHCGI-HTGSLFFIDKTLKPQTTFLTLANSSYSSDVILISFGNHKLAKKQI 195

  Fly   134 NKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDF-FGSDRPTRVRM 197
            :..::.:|...:..::  |.|...:.|.|.|...|||:|...||.|.|...:| ..:.....|.|
Mouse   196 DLAIKVKTQGKVTRLL--RNLKPPTHLFLTNYNLFKGKWKYRFNPKYTGMRNFSLSNGTNILVPM 258

  Fly   198 MHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLEK 262
            |.....|.........:..|::.:: ||::.:..||:: .:|...||.|.:.|.........|.|
Mouse   259 MQKIGWFQLKYFSHIHSYVLQLPFT-CNISGVFFLPND-GDLKECEKALLEQSFNTWIQPFPLRK 321

  Fly   263 VDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEA 327
            ..:..|.|:.....:|.....:....::|:.:.:|.|:...:..|.|:..||:|.:.::|.|...
Mouse   322 RWLFFPKFSIPVALQLESFKHVNSSLKLFNKRMDLSGITLQKAPLRVTMAVHRAELAVSEDGEGE 386

  Fly   328 AAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAGHFIT-TKV 378
            ..:.:.|.....:.|       .|.||.|...|.|. :..|||.|..:. |:|
Mouse   387 DVSNSRVNPEPGLAA-------LHFNRSFLLLILDEASKSLLFMGRVLNPTRV 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 90/369 (24%)
Serpina16XP_112098.3 serpin 61..431 CDD:393296 90/375 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.