DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpina12

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_620180.2 Gene:Serpina12 / 191570 RGDID:708485 Length:414 Species:Rattus norvegicus


Alignment Length:377 Identity:107/377 - (28%)
Similarity:180/377 - (47%) Gaps:21/377 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAESF 76
            :|...|...|...|...||..|||||..:.:||.:|..  ::|.:|:.||..|..:..:.:...|
  Rat    54 EFGFKLLQRLASNSRQGNIFLSPLSISTAFSMLSLGAQ--NSTLEEIREGFNFKEMSDRDMHMGF 116

  Fly    77 GVVL-KSYEQCQVLKMA--NGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS-EQAASIINKWV 137
            ..:| |...:.|.:||:  |.|::.:.|:..::|..:.:..:.:..:..:|.. |.....|||::
  Rat   117 HYLLQKLNRETQDVKMSIGNALFMDQRLRPQQRFLKLAKNLYDADMILTNFQDLENTQKNINKYI 181

  Fly   138 ESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPT-RVRMMHVC 201
            ..:|:|.|::::  :.:...:.:.|.|.|:|:|.|...|:.|:|:|||||..:..| :|.||...
  Rat   182 SRKTHNRIENMV--KNIDPGTVMLLTNYIYFQGRWQYEFDPKQTKEEDFFIEEGKTVKVPMMFQR 244

  Fly   202 ENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLEKVDVK 266
            ..:..|.......|.|.|.|.. |:....:||| ...|..||:.|.........|.::...|||.
  Rat   245 GMYDMAYDSQLSCTILEMPYRR-NITATFVLPD-SGKLRLLEQGLQADIFAKWKSLLSKRVVDVW 307

  Fly   267 IPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAAT 331
            :|.........:.:||..:|:::||....:| ..:.|..||.|.:.||||.:.:||.|||.||.:
  Rat   308 VPRLHISATYNMKKVLSRLGISKIFEEHGDL-TRISSHRSLKVGEAVHKAELRMNEKGTEGAAGS 371

  Fly   332 AAVATFRSMPARQGPPKVFHANRPFFYAIKDNTHGLLFAGHFITTKVEQSEK 383
            .|    :::|..  .|:....|.||...|.:|   |:.:..|:......|||
  Rat   372 GA----QTLPME--TPRRMKLNAPFLMMIYEN---LMPSMIFLARIYNPSEK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 103/365 (28%)
Serpina12NP_620180.2 alpha-1-antitrypsin_like 51..408 CDD:239011 104/369 (28%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.