DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinf2

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_032904.1 Gene:Serpinf2 / 18816 MGIID:107173 Length:491 Species:Mus musculus


Alignment Length:379 Identity:98/379 - (25%)
Similarity:174/379 - (45%) Gaps:44/379 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFG-GLEAQ 70
            ||.:..|...|...:.:.|...|::.||||:.::.:.|.:|..  :.|...:...|... |....
Mouse    83 AQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGAQ--NQTLHSLHRVLHMNTGSCLP 145

  Fly    71 QVAESFGVVLKSYEQC--QVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAASII 133
            .:...|      |:..  ..:::|..:|:.||..:.:.|....|:.|.:||:::....|:..:.|
Mouse   146 HLLSHF------YQNLGPGTIRLAARIYLQKGFPIKDDFLEQSERLFGAKPVKLTGKQEEDLANI 204

  Fly   134 NKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDR--PTRVR 196
            |:||:..|...|:|.:..  |...:.|.|:|.|||.|.|...|:...| ::|||..|.  ...|.
Mouse   205 NQWVKEATEGKIEDFLSE--LPDSTVLLLLNAIHFHGFWRTKFDPSLT-QKDFFHLDERFTVSVD 266

  Fly   197 MMHVCE---NFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAM 258
            |||...   .:|....|..:........   |::.::::|      |..|..:|::...:....:
Mouse   267 MMHAVSYPLRWFLLEQPEIQVAHFPFKN---NMSFVVVMP------TYFEWNVSEVLANLTWDTL 322

  Fly   259 ---NLEKVDVKI--PSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFI 318
               :|::...|:  |....:.|.:|...|..:|:..:|.| .:|.|:  ||::|.||.:.|::.:
Mouse   323 YHPSLQERPTKVWLPKLHLQQQLDLVATLSQLGLQELFQG-PDLRGI--SEQNLVVSSVQHQSTM 384

  Fly   319 EINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDNTHGL-LFAG 371
            |::|.|.||||||:......|:.:       |..||||.:.|.::|.|: ||.|
Mouse   385 ELSEAGVEAAAATSVAMNRMSLSS-------FTVNRPFLFFIMEDTIGVPLFVG 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 96/374 (26%)
Serpinf2NP_032904.1 alpha2AP 82..433 CDD:239008 98/379 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..491
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.