DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpind1

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001317976.1 Gene:Serpind1 / 15160 MGIID:96051 Length:478 Species:Mus musculus


Alignment Length:370 Identity:90/370 - (24%)
Similarity:163/370 - (44%) Gaps:43/370 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGG-------------------LE 68
            :|:...|:..:|:.|..:..|:.:|..  ..|.:|:...|.|..                   |.
Mouse   123 QATTSDNLFIAPVGISTAMGMISLGLR--GETHEEVHSVLHFRDFVNASSKYEVTTIHNLFRKLT 185

  Fly    69 AQQVAESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAASII 133
            .:....:||..|:|         .||||:.|...:.|.|...:.:.:.::..|.:|......|..
Mouse   186 HRLFRRNFGYTLRS---------VNGLYIQKQFPIREDFKAAMREFYFAEAQEANFPDPAFISKA 241

  Fly   134 NKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRP-TRVRM 197
            |..:...|..|||:.:  ..:...:::.::|.|:|||.|...|..:.|...:|..::|. .:|.|
Mouse   242 NNHILKLTKGLIKEAL--ENIDPATQMLILNCIYFKGTWVNKFPVEMTHNHNFRLNEREVVKVSM 304

  Fly   198 MHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLEK 262
            |....||..|.....:...|::.|.. .::|:|::|.:.|.:.:||.:|:...:|....:|....
Mouse   305 MQTKGNFLAANDQELDCDILQLEYVG-GISMLIVVPRKLSGMKTLEAQLTPQVVERWQKSMTNRT 368

  Fly   263 VDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEA 327
            .:|.:|.|..|....|.:||..||:.::|:....:.|:  |::.:.:....|::.|.:||.||:|
Mouse   369 REVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSGI--SDQRIAIDLFKHQSTITVNEEGTQA 431

  Fly   328 AAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAG 371
            ||.|.......|...|      |..:|||.:.:.:: |..|||.|
Mouse   432 AAVTTVGFMPLSTQVR------FTVDRPFLFLVYEHRTSCLLFMG 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 90/370 (24%)
Serpind1NP_001317976.1 HCII 43..476 CDD:239002 90/370 (24%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 54..78
Glycosaminoglycan-binding site. /evidence=ECO:0000250 171..191 1/19 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.