DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINA12

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:384 Identity:105/384 - (27%)
Similarity:175/384 - (45%) Gaps:27/384 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKDEEFAQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFG 65
            |..:|.|:........|...|...:.|.||..|||||..:.:||.:|..:  :|..|:.:|..|.
Human    43 MAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQD--STLDEIKQGFNFR 105

  Fly    66 GLEAQQVAESFGVVLKSYEQ-CQVLKMA--NGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS- 126
            .:..:.:.|.|..::....| .|.||::  |.|::.:.||...:|....:..:.::.:..:|.: 
Human   106 KMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNL 170

  Fly   127 EQAASIINKWVESQT----NNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFF 187
            |.|...||.::..:|    ||||::|....|      :.|.|.|.|:..|...|:...|:|||||
Human   171 EMAQKQINDFISQKTHGKINNLIENIDPGTV------MLLANYIFFRARWKHEFDPNVTKEEDFF 229

  Fly   188 -GSDRPTRVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISL 251
             ..:...:|.||.....:..........|.|.:.|.. |:..|.:|||| ..|..|||.|...:.
Human   230 LEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQK-NITAIFILPDE-GKLKHLEKGLQVDTF 292

  Fly   252 EVVSSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKA 316
            ....:.::...|||.:|........:|.:.|..:|:::||....:| ..:....||.|.:.||||
Human   293 SRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDL-TKIAPHRSLKVGEAVHKA 356

  Fly   317 FIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAI-KDNTHGLLFAGHFI 374
            .::::|.|||.||.|.|    :::|..  .|.|...::|:...| .:....:||.|..:
Human   357 ELKMDERGTEGAAGTGA----QTLPME--TPLVVKIDKPYLLLIYSEKIPSVLFLGKIV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 102/370 (28%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 105/384 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.