DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINA3

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001076.2 Gene:SERPINA3 / 12 HGNCID:16 Length:423 Species:Homo sapiens


Alignment Length:371 Identity:104/371 - (28%)
Similarity:185/371 - (49%) Gaps:27/371 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQ--QVAES 75
            ||..|:..|...:...|:|:|||||..:.|.|.:|..  :.|..|:.:||:|...|..  ::.:|
Human    56 FAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLGAH--NTTLTEILKGLKFNLTETSEAEIHQS 118

  Fly    76 FGVVLKSYEQCQ---VLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAA-SIINKW 136
            |..:|::..|..   .|.|.|.::|.:.|.:.::|....::.:.|:....||....|| .:||.:
Human   119 FQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDY 183

  Fly   137 VESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRP-TRVRMMHV 200
            |::.|...|.|:|  :.|...:.:.|||.|.||.:|.:.|:.::|.:..|:.|.:. ..|.||  
Human   184 VKNGTRGKITDLI--KDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMM-- 244

  Fly   201 CENFFFAVLPMF-----EATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNL 260
              :.....:|.|     ..|.:.:.|:. |.:.:.:|||: ..:..:|..|...:|:....::..
Human   245 --SLHHLTIPYFRDEELSCTVVELKYTG-NASALFILPDQ-DKMEEVEAMLLPETLKRWRDSLEF 305

  Fly   261 EKV-DVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVG 324
            .:: ::.:|.|:......|:.:|:.:|:...|:.:|:|.| :....:|.|||:||||.:::.|.|
Human   306 REIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSG-ITGARNLAVSQVVHKAVLDVFEEG 369

  Fly   325 TEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAI-KDNTHGLLF 369
            |||:||||...|..|  |......:...||||...| ..:|..:.|
Human   370 TEASAATAVKITLLS--ALVETRTIVRFNRPFLMIIVPTDTQNIFF 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 104/371 (28%)
SERPINA3NP_001076.2 serpinA3_A1AC 40..421 CDD:381019 104/371 (28%)
RCL 369..394 11/26 (42%)
O-glycosylated at one site 381..389 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.