DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb7

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_569088.1 Gene:Serpinb7 / 117092 RGDID:71063 Length:380 Species:Rattus norvegicus


Alignment Length:382 Identity:113/382 - (29%)
Similarity:192/382 - (50%) Gaps:38/382 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRF------G----- 65
            :|...|...:..:....|:.:|.|||..:.:::|:| :.|.. |:::|:.|.|      |     
  Rat    10 EFGFDLFREMDSSQGNGNVFFSSLSIFTALSLIRLG-ARGDC-ARQIDKALHFISPSRQGNSSNS 72

  Fly    66 --GLEAQ--QVAESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS 126
              ||:.|  :|........|.||    |.:|||::..|.....:.:....|..:.:|...:||.:
  Rat    73 QLGLQYQLKRVLADINSSHKDYE----LSIANGVFAEKVFDFHKSYMECAENLYNAKVERVDFTN 133

  Fly   127 --EQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGS 189
              ::....||||:|::|:..||.::|...|:..:.:.|||.::|||:|..:|.:.:|....|...
  Rat   134 DIQETRFKINKWIENETHGKIKKVLGDSSLSSSAVMVLVNAVYFKGKWKSAFTKSDTLSCHFRSP 198

  Fly   190 DRPTR-VRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLE- 252
            ..|.: |.|||....|..:.:.......|.:.|.. .::|.|:||::  :|:.:|.|||..:|. 
  Rat   199 SGPGKAVNMMHQERRFNLSTIQEPPMQILELQYHG-GISMYIMLPED--DLSEIESKLSFQNLMD 260

  Fly   253 -VVSSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQSEESLFVSQIVHK 315
             ..|..|..:.|:|.:|.|..|...|:...|..:|:..|| ..:|:|.| :.|...|:||:::||
  Rat   261 WTNSRKMKSQYVNVFLPQFKIEKDYEMRSHLKSVGLEDIFVESRADLSG-IASGGRLYVSKLMHK 324

  Fly   316 AFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDNTHG-LLFAG 371
            :.||::|.||||.|||.:....:.:|    ...||.|:|||.:.|:.|  | :||.|
  Rat   325 SLIEVSEEGTEATAATESNIVEKLLP----ESTVFRADRPFLFVIRKN--GIILFTG 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 113/382 (30%)
Serpinb7NP_569088.1 SERPIN 4..380 CDD:294093 113/382 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.