DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and LOC100909605

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006240581.2 Gene:LOC100909605 / 100909605 RGDID:6502633 Length:410 Species:Rattus norvegicus


Alignment Length:382 Identity:110/382 - (28%)
Similarity:183/382 - (47%) Gaps:50/382 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAESFG 77
            ||..|:..|...:...||::|..||..:..:|.:|....  |.||:.|||:|...|..: ||   
  Rat    44 FAFSLYKELVLKNPDKNIVFSSFSISTALVLLSLGAKNN--TLKEILEGLKFNLTETPE-AE--- 102

  Fly    78 VVLKSYE-----------QCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS-EQAA 130
             :.:.||           |.|: ...:.|::.|.||:..:|.......::::....||.. .:|.
  Rat   103 -IHQGYEHLLQRLNLPGDQVQI-STGSALFIKKHLQILAEFQEKARALYQAEAFSTDFQQPHEAK 165

  Fly   131 SIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPT-R 194
            .:||.:|..||...||::|.  ||.|.:.:.|||.|:|||:|.:.|:..:|.:.:|:..::.: :
  Rat   166 KLINDYVRKQTQGKIKELIS--VLDKKTSMVLVNYIYFKGKWKMPFDPHDTFQSEFYLDEKKSVK 228

  Fly   195 VRMMHVCENFFFAVLPMF-----EATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVV 254
            |.||.:.:    ...|.|     ..:.|.:.|:. |.:.:.:|||: ..:..:|..|...:|...
  Rat   229 VPMMKIEK----LTTPYFRDEELSCSVLELKYTG-NASALFILPDQ-GRMQQVEASLQPETLRRW 287

  Fly   255 SSAMNLEKVD-VKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFI 318
            ...:...::| :::|.|:......|..:|..:|:..:||.||:| ..:...:.|.|||:||||.:
  Rat   288 KDTLRPRRIDELRMPKFSISTDMRLGDILPELGIREVFSQQADL-SRITGAKDLSVSQVVHKAVL 351

  Fly   319 EINEVGTEAAAATAA-----VATFRSMPARQGPPKVFHANRPFFYAIKD-NTHGLLF 369
            ::.|.||||||||..     .|.|..:        ..:.||||...|.| |||..||
  Rat   352 DVTETGTEAAAATGVKIIPMCAKFYYV--------TMYFNRPFLMIISDTNTHIALF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 110/382 (29%)
LOC100909605XP_006240581.2 alpha-1-antitrypsin_like 41..404 CDD:239011 110/382 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.