DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and serpine1

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001108031.1 Gene:serpine1 / 100136840 ZFINID:ZDB-GENE-070912-60 Length:384 Species:Danio rerio


Alignment Length:390 Identity:108/390 - (27%)
Similarity:184/390 - (47%) Gaps:45/390 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKDEEFAQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSAT----AKEMDEG 61
            ::|::...||:.||     ...:::...|:..||..|.....|.:||..  .||    |.:|...
Zfish    21 IQDKQTDFGLQVFA-----EAVQSAPDRNLALSPYGIASVLGMAQMGAY--GATLKLLASKMGYS 78

  Fly    62 LRFGGLEAQQ------VAESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPM 120
            |:..|:...|      :|...||           ::|:|:.|.:.:.:::.|...|.:.|:|.|.
Zfish    79 LQERGMPKLQRLLQRDLASEDGV-----------EVASGVMVDRKIILEKVFRRSLSKAFQSVPH 132

  Fly   121 EIDFGS-EQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREE 184
            :|||.. |.|..:||.|....|:.:|.:.:...||::.:||..:|.:||.|.|...|:.:.|||:
Zfish   133 QIDFSQPEMARQVINSWTSDHTDGMISEFLPSGVLSELTRLVFLNALHFHGVWKTPFDPRNTREQ 197

  Fly   185 DFF---GSDRPTRVRMMHVCENFFFAVLPMFEAT---ALRMNYSACNLAMIILLPDEKS-NLTSL 242
            .|.   ||  ...|.||...:.|.:......:..   .:.|.|...:::|:::.|.||. .|::|
Zfish   198 LFHTVNGS--AVSVPMMTTTQKFNYGEFVSKDGVDYDVIEMPYEGESISMLLVTPFEKDVPLSAL 260

  Fly   243 EKKLSDISLEVVSSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESL 307
            .|:||...:......|......:.||.|:.:.:.:|...|..||:..|||........:.:||.|
Zfish   261 NKELSSSRIHQWRQEMRKISKQLSIPRFSMDTEIDLKSTLSRMGLGDIFSQSRADFSRITTEEPL 325

  Fly   308 FVSQIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAG 371
            .||:::.:..:|:||.||:.::||||| .:..|...:     ...:||||:.|:.. |..|||:|
Zfish   326 CVSKVLQRVKLEVNEEGTKGSSATAAV-IYSRMAVEE-----ITLDRPFFFLIQHKPTGALLFSG 384

  Fly   372  371
            Zfish   385  384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 105/379 (28%)
serpine1NP_001108031.1 SERPIN 26..384 CDD:294093 106/383 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.