DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and serpina10b

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_009291625.1 Gene:serpina10b / 100003661 ZFINID:ZDB-GENE-100716-5 Length:395 Species:Danio rerio


Alignment Length:384 Identity:110/384 - (28%)
Similarity:189/384 - (49%) Gaps:38/384 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KDEEFAQGLEQFALCLHDHLCRASAGLNIIYSPLSIH--ISAAMLRMGTSEGSATAKEMDEGLRF 64
            ::.:||..|.:....|||.        |:::||||:.  .||.:|   .::|| |..|:.:||..
Zfish    34 RNTDFAINLYRKISSLHDR--------NVVFSPLSVSTCFSALLL---AAQGS-TRTEILKGLNL 86

  Fly    65 GGL---EAQQVAESFGVVLKSYEQCQVLKMANG--LYVMKGLQVDEQFGHILEQKFRSKPMEIDF 124
            ..|   ::::|.|.|    :...|...|:|..|  |::.:...:...|...:::.|.::.:.:||
Zfish    87 EALDGGDSRRVPELF----QQLHQNISLQMEQGTALFLDQHFHLQTNFSQQIQRFFNAEVLRVDF 147

  Fly   125 GSEQAA-SIINKWVESQTNNLIKDII-GPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFF 187
            ...... |:||::|..:|...:.::: ....||   ::.|:|.|.:||:|...||...|.:..|:
Zfish   148 SKPAVCRSLINEFVSRKTGRKVLEMLESVEPLT---QMLLLNTIFYKGDWERPFNPNNTEKSRFY 209

  Fly   188 -GSDRPTRVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISL 251
             ......:|.||.:.|.|.........|..||:.|.. ..:|:||||...::.|::|.::|...|
Zfish   210 VDKYNIVQVPMMMLEEKFSVVEDRDLRARVLRLPYRG-GASMLILLPSADADYTAIEDEISAERL 273

  Fly   252 EVVSSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKA 316
            ......|...|::|.:|.|..:....:.::|..:|::.:|...|:|.| |..:..|.|||::|||
Zfish   274 HGWIKNMRRMKMEVHLPRFRMDQSYHMHELLPQLGISSVFQDSADLTG-LSRDAHLKVSQVLHKA 337

  Fly   317 FIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAI-KDNTHGLLFAGHFI 374
            .||:.|.||.||::|:...|..|:      |..|..|||||:.: .:.|..|||.|..|
Zfish   338 VIEVYEQGTSAASSTSVGITAYSL------PDTFIINRPFFFFLYHEETASLLFMGRVI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 106/371 (29%)
serpina10bXP_009291625.1 Serpin 35..392 CDD:278507 110/383 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.