DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9447 and CG14219

DIOPT Version :10

Sequence 1:NP_610243.4 Gene:CG9447 / 35597 FlyBaseID:FBgn0033110 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_608322.1 Gene:CG14219 / 32951 FlyBaseID:FBgn0031033 Length:724 Species:Drosophila melanogaster


Alignment Length:57 Identity:16/57 - (28%)
Similarity:26/57 - (45%) Gaps:4/57 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 MTWDSLVATFGGIFGLCMG-GSVLSIVELVYYFTIKPFTVQREAKRAKRKGGNTLVH 502
            ::|..:..|.....||.:| |:|.|   .||.|.|:..::.:...:..||....|.|
  Fly    99 LSWFGIPFTIQLFVGLIIGNGAVCS---YVYLFEIRSSSLPQNRFKITRKSTRLLYH 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9447NP_610243.4 Acyl_transf_3 222..620 CDD:426413 16/57 (28%)
CG14219NP_608322.1 NRF 101..211 CDD:214781 16/55 (29%)
OafA 284..676 CDD:441440
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.