DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9447 and CG32645

DIOPT Version :9

Sequence 1:NP_610243.4 Gene:CG9447 / 35597 FlyBaseID:FBgn0033110 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_727670.1 Gene:CG32645 / 32264 FlyBaseID:FBgn0052645 Length:853 Species:Drosophila melanogaster


Alignment Length:606 Identity:143/606 - (23%)
Similarity:241/606 - (39%) Gaps:109/606 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LISYYDKVHRRDAM-NSDRDLFNKEVVK---GCLNQKFSEKFSLRTRSLIEYCVSASDKDLKMDL 148
            |...|.:...::|: ..|:::.|.....   ||.:..:|:..:.....|.:...|.|...||.  
  Fly   298 LFEIYLRRKLKEALRRQDKEMMNNSETSSGIGCASSDYSDTMTAHDDPLKQSDHSQSSNSLKQ-- 360

  Fly   149 LDLAFYGILVVILFITLCSSFLD------------------YRLSKMNSQKSE------------ 183
            ||         .|.:.|..:..|                  :|....||...|            
  Fly   361 LD---------ALVLNLPPNDNDSGNGHHHDHDAEHDHHDHHRSGSNNSNSDEHLEGHLHEPEKL 416

  Fly   184 SFYREPLMDRRQRLLTSFSVVRNYHRLVEPYNSDFSRD-VSFFDGFRVIGVFVVILGHTLMVFMT 247
            |.|.|        ||.|||.:.|::.:.:   .:...| :....|.|...:..||||||.:|...
  Fly   417 SIYSE--------LLLSFSAITNFNAICD---RNVGADTIPCIHGLRAFSMAWVILGHTCIVVFK 470

  Fly   248 VPIENPEFFEQFLFRFETSIFQNGSLVIQIFFVMSGFLL-YVKFTKRQQIQPKTGTLE------- 304
            .. :|.|..::....|......||...:..||.:||||: |:.|  |...:.|...|.       
  Fly   471 YS-DNMEMRKEVEQNFFFQAITNGPFSVDTFFFISGFLISYIYF--RTNAKGKLNKLSKGANEFT 532

  Fly   305 -CIAVYFRVFSYRYFRL-LPSLLALILFNGTLLVRLQ--------NGPFWRHLTEAERVFCRANW 359
             ..|.:|.:.:||:.|| .|.|..|    |.:.|.::        :.|...|:|      |...|
  Fly   533 AGTAHFFGLVAYRFMRLTAPYLFVL----GVVQVTMKYLATYSIFDPPTMDHIT------CPDYW 587

  Fly   360 WKNVFFV-TNHMLEDSCSHQTWYLGADMQLFELFLIVIIITKKHPKLTRTIYTTLLALAFAVPAV 423
            |:|:.:: |...:::.|...:|||..|.|.:.:..|::|:..:|.||:.......|.|::...||
  Fly   588 WRNILYINTLFPVDEMCMLWSWYLANDTQFYMIGAIILIVGVRHFKLSAITTLVFLVLSWITTAV 652

  Fly   424 LTYVLELDGIYHIRPETYRYLYFRHSDTFYQMYPPFYTNLGGYLFGFLCGHFYLRQRSGNVEL-L 487
            :.:.      .:.||.|...|..     |.::|...:|.||.||.|...|....|.   |.:: |
  Fly   653 IAFT------NNHRPNTDDPLAL-----FDKIYDKPWTRLGPYLIGMAVGWILFRT---NCKIRL 703

  Fly   488 GHLKYDLAMWLLVLATLGVLFSGYIFIRQDFAKPSLWLALYAGIHKILWVLICAGFVILMCRKVG 552
            ..|....| |.|.:..|.||..|  ..:.|.::  ...|.|:.:....|.|..|...|......|
  Fly   704 PKLTVATA-WTLAMLNLFVLVFG--LYKADLSQ--FTAAAYSSLSHSAWALSLAWITIACSTGYG 763

  Fly   553 GIAYDFCTLPAFRPLARISFQSFLWHIVVLRTVAGNFRQPVYVSSFFLLCNVFSVFILTQFVAAL 617
            |......:.|...|.:|:::.::|.|.:|:|::|.|...|:::....::...|.:.:.:.|::.:
  Fly   764 GYINSLLSAPCLYPFSRVTYCAYLVHPIVIRSMALNSDAPLHLGGDLMVVMFFGLTVASYFLSFV 828

  Fly   618 VAVLLEYPFVEVLRCLIKPEK 638
            |::..|.|.|.:|:.|....|
  Fly   829 VSMSFEAPVVTMLKILSPSRK 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9447NP_610243.4 Acyl_transf_3 222..611 CDD:280013 103/408 (25%)
OafA 225..631 CDD:224748 108/425 (25%)
CG32645NP_727670.1 NRF 121..272 CDD:214781
Acyl_transf_3 445..831 CDD:280013 105/417 (25%)
OafA 450..853 CDD:224748 111/432 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.