DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9447 and CG33337

DIOPT Version :9

Sequence 1:NP_610243.4 Gene:CG9447 / 35597 FlyBaseID:FBgn0033110 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_996269.2 Gene:CG33337 / 2768678 FlyBaseID:FBgn0053337 Length:708 Species:Drosophila melanogaster


Alignment Length:663 Identity:148/663 - (22%)
Similarity:259/663 - (39%) Gaps:120/663 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LYQLDDYDLCL----DNQAGTYCLVYVEILP----NASSALWHQIDQVSQDSKHRFRHDRVFRGV 60
            :|.|.::|.|:    |:..|.||  ::::.|    ...|:|...:              ::....
  Fly   107 VYDLGNFDECINIKKDSIRGKYC--FLDVSPAKILGVESSLAGIL--------------KIKTAT 155

  Fly    61 CL-ESCKQRINHLSEFREYEKEEILDKELISYYDKVHRRDAMNSDRDLFNKEVVKGCLNQKFSEK 124
            |. .||.  ..|:::|.:...:.||:..:.|        .||:...|        .|...: ||.
  Fly   156 CFPASCS--ATHMNKFVDTILKRILNVSIPS--------TAMSISDD--------SCQTAE-SEP 201

  Fly   125 FSLRTRSLIEYCVSASDKDLKMDLLDLAFYGILVVILFITLCSSFLDYRLSKMNSQKSESFYREP 189
            :|..|               .:.::.|:..|::|.|      ::..||.|.|...|...:.   .
  Fly   202 WSGLT---------------ILTIVILSLMGVIVAI------ATLYDYFLVKSQDQLHTAV---K 242

  Fly   190 LMDRRQRLLTSFSVVRNYHRLVEPYNSDFSRDVSFFDGFRVIGVFVVILGHTLMVFMTVPIENPE 254
            |...|......|.:|         .|......:....|.|.:.:|.|:..|......:.|..|..
  Fly   243 LFSARANSCALFRIV---------VNQSNPNVIECLHGIRCMSLFWVVWIHQYDNVFSAPNINRF 298

  Fly   255 FFEQFLFRFETSIFQNGSLVIQIFFVMSGFLLYVKFTKRQQIQPKTGTLECIAVYFRVFSYRYFR 319
            .|..:|....|..|..|:..:..||.:.|||  |.......::...|.:....:|.|    |:.|
  Fly   299 RFLSWLQTPFTMFFLEGNFSVDSFFFIGGFL--VSLNALGTMEKNNGKINVPRMYIR----RFIR 357

  Fly   320 LLPSLLALILFNGTLLVRLQNGPFWRHLTEAERVFCRANWWKNVFFVTNHMLEDSCSHQTWYLGA 384
            :.|.|...||....|...|.:||.::. ..:::..|...|:..:.||.| ...|.|...||||..
  Fly   358 IFPILAMSILVYTQLTGVLGDGPLFKG-GYSKKASCAKTWYMTLLFVVN-FANDMCLDHTWYLAV 420

  Fly   385 DMQLFELFLIVIIITKKHPKLTRTIYTTLLAL----AFAVPAVLTY-VLELDGIYHIRPETYRYL 444
            |||||.:..|::....|..|........|:.|    .||...|..| :..||  :.::.:||.|.
  Fly   421 DMQLFLISPILLFALYKWGKKAAAAIGVLIVLLSGCLFATMMVNHYSIKSLD--FSLQKKTYFYT 483

  Fly   445 YFRHSDTFYQMYPPFYTNLGGYLFGFLCGHFYLRQRSGNVELLGHLKYDLAMWLLVLATLGVLFS 509
                           :|:...:|.|||.|:|....:....::..     :|:|...:..|.:||:
  Fly   484 ---------------HTHAAPWLIGFLYGYFVFLNKGRKFKMNW-----IAVWSGWILCLAMLFT 528

  Fly   510 GY--IFIRQDFAKPSLWLAL----YAGIHKILWVLICAGFVILMCRK-VGGIAYDFCTLPAFRPL 567
            ..  ::.:.:..||.|...|    |..:.::.|.: ..|:|:..|.: .||:|..|.:.|.::|:
  Fly   529 SIFALYPKLESGKPWLMTTLEVSSYYTLTRVGWPM-AVGWVVFACMQGYGGMANTFLSSPLWQPI 592

  Fly   568 ARISFQSFLWHIVVLRTVAGNFRQPVYVSSFFLLCNVFSVFILTQFVAALVAVLLEYPFVEVLRC 632
            :::|:..::||..:........|...|.|::.::.|.:|....|...:.|:.:|:|.|...:.|.
  Fly   593 SKLSYSIYIWHSFIQEINKRIVRTNTYFSNYQVMLNFWSTMGFTVLFSYLLYLLIEAPIGGLDRL 657

  Fly   633 LIKPEKGPEEVGP 645
            |...:|.|.|..|
  Fly   658 LRPKKKAPAENKP 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9447NP_610243.4 Acyl_transf_3 222..611 CDD:280013 96/400 (24%)
OafA 225..631 CDD:224748 101/417 (24%)
CG33337NP_996269.2 NRF 85..196 CDD:214781 23/122 (19%)
Acyl_transf_3 266..645 CDD:280013 98/409 (24%)
OafA 300..666 CDD:224748 97/396 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.