DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9447 and oac-54

DIOPT Version :9

Sequence 1:NP_610243.4 Gene:CG9447 / 35597 FlyBaseID:FBgn0033110 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_495953.3 Gene:oac-54 / 189275 WormBaseID:WBGene00012323 Length:477 Species:Caenorhabditis elegans


Alignment Length:472 Identity:104/472 - (22%)
Similarity:191/472 - (40%) Gaps:96/472 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 LLTSFSVVRNYHRLVEPYNSDFSRDVSFFDGFRVIGVFVVILGHT--------------LMVFMT 247
            :|::.|:.|:...|:    :..|..:.|.|.||.:.:..|::.||              ...|.:
 Worm    46 ILSALSLKRSIKELL----TGRSSKLDFIDIFRCVAIIWVMINHTGGRGRIDVLEGLSSAEAFTS 106

  Fly   248 VPIENPEFFEQFLFRFETSIFQNGSLVIQIFFVMSGFLLYVKFTKRQQIQPKTGTLECIAVYFR- 311
            ....:|.|         .::..|.:|.::||.|:|| ||..:...|:..:|          :|: 
 Worm   107 AMHNHPIF---------GALMGNSALGVEIFLVLSG-LLAARSWLRKADEP----------FFQH 151

  Fly   312 ---VFSYRYFRLLPSLLALILFNGTLLVRLQNGP----FWRHLTEAERVFCRANWWK--NVF-FV 366
               ....|..||.|     ::|   :.:.:..||    |....|.:....|  .:|.  ::| |.
 Worm   152 WITFIIRRILRLAP-----VMF---IFIYIAIGPIMKKFLPRFTFSSVSSC--GFWNIISLFTFT 206

  Fly   367 TNHMLEDSCSHQTWYLGADMQLFELFLIVIIITKKHPK--LTRTIYTTLLALAFAVPAVLTYV-- 427
            .|.....:|....||||.||||:.:..|.:.:..|.||  :..|| ||::|..|......|..  
 Worm   207 GNLQTSPTCMTYIWYLGLDMQLYMVASIFLSLLHKSPKRGIVLTI-TTIIASMFIRAGYCTAYGT 270

  Fly   428 ---LELDGIYHIRPETYRYLYFRHSDTFYQMYPPFYTNLGGYLFGFLCGHFYLRQRSGNVELLGH 489
               .::|..:..:|.....:..|..:..:.:|...||..|.:|.|.|.|:..:..:        :
 Worm   271 CNHSDVDVAFITKPGQDPAVLARSYEGLWLIYSRPYTKCGPFLIGLLLGYTTVSSK--------Y 327

  Fly   490 LKYDLAMWLLVLATLGVLFSGYIFIRQDFAKP----SLWLALYAGIHKILWVLICAGFVILMCRK 550
            :..|....::..::|.|..:....|..::..|    :|:..:|..:.:.::.:..:|.:..|..|
 Worm   328 IMSDALTKIVFRSSLFVAIATIYAILPEYWNPNAGNTLYNTVYTAVFRSVFAMAISGMIAAMYFK 392

  Fly   551 VGGIAYDFC--TLPAFRPLARISFQSFLWHIVVLRTVAGNFRQPVYVSSFFLLCNVFSVFILTQF 613
            .|      |  |...|..|.:::|.::|.|:.|:.|..       ::|......:...:|::..|
 Worm   393 EG------CSSTPLVFSILGKLTFNTYLLHMPVVYTFN-------WLSFLQTATSPIELFLVIPF 444

  Fly   614 VAAL--VAVLLEYPFVE 628
            :|.|  ||.|..|.|||
 Worm   445 IAMLSYVAALFFYLFVE 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9447NP_610243.4 Acyl_transf_3 222..611 CDD:280013 89/426 (21%)
OafA 225..631 CDD:224748 98/444 (22%)
oac-54NP_495953.3 OafA 64..473 CDD:224748 100/450 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.