DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment coro and RIB7

DIOPT Version :9

Sequence 1:NP_001260743.1 Gene:coro / 35596 FlyBaseID:FBgn0265935 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_009711.3 Gene:RIB7 / 852450 SGDID:S000000357 Length:244 Species:Saccharomyces cerevisiae


Alignment Length:261 Identity:51/261 - (19%)
Similarity:81/261 - (31%) Gaps:92/261 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 CAVNPKFLAIIVESAGGGAFIVLPHNKVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDC 104
            |...|:||...:.:||               ..::.:|     |.:.:.:....|..::.|.   
Yeast     7 CEDLPQFLQNYLPNAG---------------QTENTIV-----PFVTLTYAQSLDARVSRGP--- 48

  Fly   105 VVKVWQIPDGGLSRTLTEPVVDLVFHQRR---------VGLVL---------WHPSALNVLLTAG 151
                      |:..|::.|....:.|..|         .|.||         |.|..     .|.
Yeast    49 ----------GVRTTISHPETKTMTHYLRHHHDGILVGSGTVLADNPGLNCKWGPDP-----AAN 98

  Fly   152 SDNQVVI-----WNVGTG---EILVHIDSHPDIV--------------YSACFNWDGSKLVTTCK 194
            |...::|     |.....   |:.:.....|.||              |:.|...|.:|||    
Yeast    99 SPRPIIIDTKQKWRFDGSKMQELFIKRQGKPPIVVVTSEPIIKEQHVDYAICPINDTTKLV---- 159

  Fly   195 DKKIRIYDPRTAELE-SEAMCHEGSKATRAIFLR----HGLIFTTG--FNRSSERQYSLRAPDAL 252
            |.| ::::....|.. ...|...|:.....:.||    :.||.|.|  |..||..:.|  .|..:
Yeast   160 DWK-KLFEILKEEFNIRSVMVEGGANVINQLLLRSDIVNSLIITIGSTFLGSSGTEVS--PPQTV 221

  Fly   253 N 253
            |
Yeast   222 N 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coroNP_001260743.1 DUF1899 7..64 CDD:286094 6/23 (26%)
WD40 repeat 37..78 CDD:293791 6/37 (16%)
WD40 79..294 CDD:295369 44/222 (20%)
WD40 repeat 85..129 CDD:293791 5/43 (12%)
WD40 repeat 134..171 CDD:293791 10/53 (19%)
WD40 repeat 178..213 CDD:293791 9/35 (26%)
WD40 repeat 220..260 CDD:293791 12/40 (30%)
WD40 repeat 267..308 CDD:293791
WD40_4 343..385 CDD:292916
RIB7NP_009711.3 ribD_Cterm 28..241 CDD:129330 45/225 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1985
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.