DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment coro and AT1G48870

DIOPT Version :9

Sequence 1:NP_001260743.1 Gene:coro / 35596 FlyBaseID:FBgn0265935 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001319178.1 Gene:AT1G48870 / 841309 AraportID:AT1G48870 Length:593 Species:Arabidopsis thaliana


Alignment Length:245 Identity:56/245 - (22%)
Similarity:96/245 - (39%) Gaps:34/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQI--PDGGLSRTLTE----------------- 122
            :.||||.:..:.:.| :...:|:|.||.|||:|:|  .|..|:..|.:                 
plant   194 INGHKGKIWTLKFSP-DGKYLATGGEDGVVKIWRITLSDSLLASFLRQQEPINQQAALVLFPQKA 257

  Fly   123 ------PVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSHPDIVYSAC 181
                  |..:|..|...|..:.|..|  |:||:|..|..|.:|..|..:.| |:..|.:.|....
plant   258 FHIEETPFQELYGHTGDVLDLAWSDS--NLLLSASKDKTVRLWRTGCDQCL-HVFHHNNYVTCVE 319

  Fly   182 FN-WDGSKLVTTCKDKKIRIYDPRTAELESEAMCHEGSKATRAIFLRHGLIFTTGFNRSSERQYS 245
            || .:.:...:...|.|.||:.  .:|....|........:...:..:|..|..|....:.|.|.
plant   320 FNPVNKNNFASGSIDGKARIWG--LSEERVVAWTDVRDSISAISYQPNGNGFVVGCITGNCRFYQ 382

  Fly   246 LRAPDALNEPIVMVELDTSNGVMFPLYDADTNMIYLCGKGDSVIRYFEVT 295
            :...|.:.:..:::.  ..|.:....:...::...|....||.:|.|:.|
plant   383 ILDNDVIMDEQILIR--GRNRITAVEFCPGSSEKILVSSEDSKVRIFDKT 430

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
coroNP_001260743.1 DUF1899 7..64 CDD:286094