DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15236 and PPR1

DIOPT Version :9

Sequence 1:NP_610241.1 Gene:CG15236 / 35595 FlyBaseID:FBgn0033108 Length:807 Species:Drosophila melanogaster
Sequence 2:NP_013114.1 Gene:PPR1 / 850701 SGDID:S000004004 Length:904 Species:Saccharomyces cerevisiae


Alignment Length:175 Identity:39/175 - (22%)
Similarity:65/175 - (37%) Gaps:41/175 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVKSAESEILL---GIIRSDSMTSGNSLRSCLLLATILGLLCRTKALPFEYLDEHEDFNYDLDTA 64
            ||.|...|.:|   |::....:..|||:.|..:.:       ::.|.|.....:.::|     ..
Yeast   121 SVSSLGEEGILPHNGLLADYLVQKGNSMASSAITS-------KSMASPQTINVQRKEF-----LV 173

  Fly    65 QSQAKYDARLLSQ---QMLSDA---ELQRQG--------LSDGQDNALDGDS-----AAAQGTGA 110
            .|:.:..:.||.:   .|.|||   ||:|..        :.:...|:..|||     |....|..
Yeast   174 NSKKQDGSALLPETGSPMTSDARAEELRRCNKEISALGTMRESSFNSFLGDSSGISFAKLVFTAT 238

  Fly   111 GSHLDAVSSVHD-DLEPHSRAAACFTNGHKYTHGQKVPRLDACEV 154
            ....|:...|.| |::...:.    .||  |...:..|..|..|:
Yeast   239 NFRQDSGDDVLDEDIKQREQK----YNG--YAEAENNPHFDPLEL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15236NP_610241.1 None
PPR1NP_013114.1 GAL4 28..70 CDD:214501
ZIP_Ppr1 72..96 CDD:271240
coiled coil 75..96 CDD:271240
fungal_TF_MHR 278..744 CDD:213391 39/175 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28IQG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.