DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment koi and Spag4

DIOPT Version :9

Sequence 1:NP_001260738.1 Gene:koi / 35594 FlyBaseID:FBgn0265003 Length:965 Species:Drosophila melanogaster
Sequence 2:XP_038961871.1 Gene:Spag4 / 83623 RGDID:620151 Length:454 Species:Rattus norvegicus


Alignment Length:237 Identity:73/237 - (30%)
Similarity:118/237 - (49%) Gaps:12/237 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   730 EIERSSILLMSDISQRLK------REILLVVEAKHNESTKALKGHIREEEVRQIVKTVLAIYDAD 788
            |.|...:|.:|....|:.      :::...:...|.|.|.     :|.....::.|.|....:.|
  Rat   205 ENEPKEMLTLSQYHHRVHSQGQQLQQLQAELSKLHKEVTS-----VRAAHSERVAKLVFQRLNED 264

  Fly   789 KTGLVDFALESAGGQILSTRCTESYQTKSAQISVFGIPLWYPTNTPRVAISPNVQPGECWAFQGF 853
            .....|:||.|.|..|...:.:..|:.::.......:..|.....|.|.:.|:|.||.||||:|.
  Rat   265 FVRKPDYALSSVGASIDLEKTSSDYEDRNTAYFWNRLSFWNYARPPSVILEPDVFPGNCWAFEGE 329

  Fly   854 PGFLVLKLNSLVYVTGFTLEHIPKSLSPTGRIESAPRNFTVWGLEQEKDQEPVLFGDYQFEDNGA 918
            .|.:|::|...|.::..||:|.|.:::.||...||||:|.|:||:.:.|:..|..|.:.||...:
  Rat   330 QGQVVIRLPGHVQLSDITLQHPPPTVAHTGGASSAPRDFAVFGLQADDDETEVFLGKFIFEVQKS 394

  Fly   919 SLQYFAVQNLDIKRPYEIVELRIETNHGHPTYTCLYRFRVHG 960
            .:|.|.:|| |....:..|:::|.:|.|||.:|||||.|.||
  Rat   395 EIQTFHLQN-DPPSAFPKVKIQILSNWGHPRFTCLYRVRAHG 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
koiNP_001260738.1 Sad1_UNC 827..962 CDD:285038 54/134 (40%)
Spag4XP_038961871.1 Sad1_UNC 303..436 CDD:400199 54/134 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1569602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12911
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X471
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.