DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment koi and SUN2

DIOPT Version :9

Sequence 1:NP_001260738.1 Gene:koi / 35594 FlyBaseID:FBgn0265003 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_566380.2 Gene:SUN2 / 820242 AraportID:AT3G10730 Length:455 Species:Arabidopsis thaliana


Alignment Length:353 Identity:83/353 - (23%)
Similarity:162/353 - (45%) Gaps:73/353 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   648 LLAEIENKLSALNDSQFALLNKQI------KLSLVEILGFKQSTAGGSAGQLDDFDLQTWVRSMF 706
            |:.::..|.|:|:.|.|.:..:.:      ::|.|:.|                  ::|..:.|.
plant   127 LIRKLTLKDSSLSSSNFPIETEMVLSELESRISAVDGL------------------VKTTTKMMQ 173

  Fly   707 VAKDYLEQQLLELNKRTNNNIRDEIERSSILLMSDISQ-RLKREILLV----VEAKHNESTKAL- 765
            |..::|::::    ...:..:|..|:.:|.:|.|::.: ..|.|.|.|    :.||...|.:.| 
plant   174 VQVEFLDKKM----DSESRALRQTIDSTSSVLHSELKKVESKTERLQVSVDELNAKPLVSREELE 234

  Fly   766 -------KGHIREEEV---------RQIVKTVLAIYDADKTGLVDFALESAGGQILSTRCTESYQ 814
                   ||.:.:.:|         |.||:..:..:.||..|.||:||.|.|..::.        
plant   235 RVYEELKKGKVGDSDVNIDKLRAYARDIVEKEIGKHVADGLGRVDYALASGGAFVMG-------- 291

  Fly   815 TKSAQISVFGIPLWYPTNTPRV------AISPNV-QPGECWAFQGFPGFLVLKLNSLVYVTGFTL 872
             .|....|.....|:.|:..||      .::|:. :||:|:..:|..|:::::|.:.:.....||
plant   292 -HSDPFLVGNGRNWFGTSRRRVHSKAVKMLTPSFGEPGQCFPLKGSNGYVLVRLRAPIIPEAVTL 355

  Fly   873 EHIPKSLSPTGRIESAPRNFTVWG----LEQEKDQEPVLFGDYQFEDNGASLQYFAVQNLDIKRP 933
            ||:.|:::...  .|||::..|.|    ::.|.:..|:| .::.::.:.::.|.|.:.:......
plant   356 EHVSKAVAYDR--SSAPKDCRVSGWLGDIDMETETMPLL-TEFSYDLDRSNAQTFDIADSAHSGL 417

  Fly   934 YEIVELRIETNHGHPTYTCLYRFRVHGK 961
            ...|.|...:|||..::||:|||||||:
plant   418 VNTVRLDFNSNHGSSSHTCIYRFRVHGR 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
koiNP_001260738.1 Sad1_UNC 827..962 CDD:285038 40/146 (27%)
SUN2NP_566380.2 Sad1_UNC 310..445 CDD:285038 37/137 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3507
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1569602at2759
OrthoFinder 1 1.000 - - FOG0000864
OrthoInspector 1 1.000 - - otm3562
orthoMCL 1 0.900 - - OOG6_102039
Panther 1 1.100 - - O PTHR12911
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X471
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.