DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment koi and Sun5

DIOPT Version :9

Sequence 1:NP_001260738.1 Gene:koi / 35594 FlyBaseID:FBgn0265003 Length:965 Species:Drosophila melanogaster
Sequence 2:XP_006500435.2 Gene:Sun5 / 76407 MGIID:1923657 Length:390 Species:Mus musculus


Alignment Length:219 Identity:71/219 - (32%)
Similarity:117/219 - (53%) Gaps:16/219 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   758 HNESTKALKGHIRE-----------EEVRQIVKTVLAIYDADKTGLVDFALESAGGQILSTRCTE 811
            |....:.|:|.:.:           .:.:::.:.::.:...|.....||||:|.|..|.....:.
Mouse   166 HTGEIQDLRGSMNQLIAKLQKMEAISDEQKMAQKIMKMIQGDYIEKPDFALKSIGASIDFEHTSA 230

  Fly   812 SYQTKSAQISVFGIPLWYPTNTPRVAISPNVQPGECWAFQGFPGFLVLKLNSLVYVTGFTLEHIP 876
            :|....|:.....|.||.....|.|.:.|||.||.||||....|.:.::|...||::..||:|||
Mouse   231 TYNHDKARSYWNWIRLWNYAQPPDVILEPNVTPGNCWAFASDRGQVTIRLAQKVYLSNITLQHIP 295

  Fly   877 KSLSPTGRIESAPRNFTVWGLEQEKDQEPVLFGDYQFEDNGASLQYFAVQNLDIKRPYEIVELRI 941
            |::|.:|.:::||::|.::||| ...:|.|..|.:||:.... :|.|.:|||. .|.:..|:::|
Mouse   296 KTISLSGSLDTAPKDFVIYGLE-SLPREEVFLGAFQFQPENI-IQTFQLQNLP-PRSFAAVKVKI 357

  Fly   942 ETNHGHPTYTCLYRFRVHGK--PP 963
            .:|.|:|.:||:||.||||.  ||
Mouse   358 SSNWGNPRFTCMYRVRVHGSVTPP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
koiNP_001260738.1 Sad1_UNC 827..962 CDD:285038 55/136 (40%)
Sun5XP_006500435.2 Sad1_UNC 246..378 CDD:369494 55/134 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1569602at2759
OrthoFinder 1 1.000 - - FOG0000864
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12911
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X471
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.