DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment koi and SPAG4

DIOPT Version :9

Sequence 1:NP_001260738.1 Gene:koi / 35594 FlyBaseID:FBgn0265003 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_003107.1 Gene:SPAG4 / 6676 HGNCID:11214 Length:437 Species:Homo sapiens


Alignment Length:238 Identity:75/238 - (31%)
Similarity:119/238 - (50%) Gaps:15/238 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   730 EIERSSILLMSDISQRLK------REILLVVEAKHNE-STKALKGHIREEEVRQIVKTVLAIYDA 787
            |.|...:|.:|:..:|::      :::...::..|.| ||      :|.....::.|.|....:.
Human   193 ENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVST------VRAANSERVAKLVFQRLNE 251

  Fly   788 DKTGLVDFALESAGGQILSTRCTESYQTKSAQISVFGIPLWYPTNTPRVAISPNVQPGECWAFQG 852
            |.....|:||.|.|..|...:.:..|..::..........|.....|.|.:.|:|.||.||||:|
Human   252 DFVRKPDYALSSVGASIDLQKTSHDYADRNTAYFWNRFSFWNYARPPTVILEPHVFPGNCWAFEG 316

  Fly   853 FPGFLVLKLNSLVYVTGFTLEHIPKSLSPTGRIESAPRNFTVWGLEQEKDQEPVLFGDYQFEDNG 917
            ..|.:|::|...|.::..||:|.|.|:..||...||||:|.|:|| |..|:..|..|.:.|:...
Human   317 DQGQVVIQLPGRVQLSDITLQHPPPSVEHTGGANSAPRDFAVFGL-QVYDETEVSLGKFTFDVEK 380

  Fly   918 ASLQYFAVQNLDIKRPYEIVELRIETNHGHPTYTCLYRFRVHG 960
            :.:|.|.:|| |....:..|:::|.:|.|||.:|||||.|.||
Human   381 SEIQTFHLQN-DPPAAFPKVKIQILSNWGHPRFTCLYRVRAHG 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
koiNP_001260738.1 Sad1_UNC 827..962 CDD:285038 55/134 (41%)
SPAG4NP_003107.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88
Sad1_UNC 291..422 CDD:311603 53/132 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1569602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12911
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X471
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.