DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment koi and SUN3

DIOPT Version :9

Sequence 1:NP_001260738.1 Gene:koi / 35594 FlyBaseID:FBgn0265003 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_001025190.1 Gene:SUN3 / 256979 HGNCID:22429 Length:357 Species:Homo sapiens


Alignment Length:336 Identity:100/336 - (29%)
Similarity:173/336 - (51%) Gaps:29/336 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   646 HGLLAEIEN-KLSALNDSQFALLNKQIKLS--LVEILGFKQSTAGGSAGQLDDFDLQTWVRSMF- 706
            :.||:|.|| ..:.:..|...:|:..:.|:  ||.:|..:         .|.:.|:....|.:: 
Human    28 NALLSEDENPDANGVTRSWKIILSTMLTLTFLLVGLLNHQ---------WLKETDVPQKSRQLYA 83

  Fly   707 VAKDY------------LEQQLLELNKRTNNNIRDEIERSSILL-MSDISQRLKREILLVVEAKH 758
            :..:|            :.::.|||.|:.:.|:.:...:...|: ..|:.:.|.|::...::..|
Human    84 IIAEYGSRLYKYQARLRMPKEQLELLKKESQNLENNFRQILFLIEQIDVLKALLRDMKDGMDNNH 148

  Fly   759 NESTKA--LKGHIREEEVRQIVKTVLAIYDADKTGLVDFALESAGGQILSTRCTESYQTKSAQIS 821
            |.:|..  ::.....|||..:|..||.....|:..:.|:||:|||..|:....:|||:...|::.
Human   149 NWNTHGDPVEDPDHTEEVSNLVNYVLKKLREDQVEMADYALKSAGASIIEAGTSESYKNNKAKLY 213

  Fly   822 VFGIPLWYPTNTPRVAISPNVQPGECWAFQGFPGFLVLKLNSLVYVTGFTLEHIPKSLSPTGRIE 886
            ..||........|.:.:.|:|.||:||||.|..|..::||.:.:..|..|:|||.:.:||:|.|.
Human   214 WHGIGFLNHEMPPDIILQPDVYPGKCWAFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSGNIS 278

  Fly   887 SAPRNFTVWGLEQEKDQEPVLFGDYQFEDNGASLQYFAVQNLDIKRPYEIVELRIETNHGHPTYT 951
            |||:.|:|:|:.::.:.|.:..|.:.:...|.::|.|.:|:. :......|:|.|.:|.|||.||
Human   279 SAPKEFSVYGITKKCEGEEIFLGQFIYNKTGTTVQTFELQHA-VSEYLLCVKLNIFSNWGHPKYT 342

  Fly   952 CLYRFRVHGKP 962
            |||||||||.|
Human   343 CLYRFRVHGTP 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
koiNP_001260738.1 Sad1_UNC 827..962 CDD:285038 52/134 (39%)
SUN3NP_001025190.1 Sad1_UNC 219..353 CDD:285038 52/134 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1569602at2759
OrthoFinder 1 1.000 - - FOG0000864
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12911
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X471
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.