DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment koi and Sun3

DIOPT Version :9

Sequence 1:NP_001260738.1 Gene:koi / 35594 FlyBaseID:FBgn0265003 Length:965 Species:Drosophila melanogaster
Sequence 2:XP_006514658.1 Gene:Sun3 / 194974 MGIID:3041199 Length:344 Species:Mus musculus


Alignment Length:257 Identity:89/257 - (34%)
Similarity:146/257 - (56%) Gaps:12/257 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   713 EQQLLELNKRT-NNNIRD---EIERSSIL--LMSDISQRLKREILLV-VEAKHNESTKALKGHIR 770
            :|:||:...:| .||.|:   .||:..:|  |:.|:...:....|.| .:|..:::|.    .:.
Mouse    89 QQELLKKESQTLENNFREILFLIEQIDVLKALLKDMKDGVHNHSLPVHRDAVQDQATT----DVL 149

  Fly   771 EEEVRQIVKTVLAIYDADKTGLVDFALESAGGQILSTRCTESYQTKSAQISVFGIPLWYPTNTPR 835
            :||:..:|..||..:..|:..|.|:||:|||..::....:|||:...|::...||........|.
Mouse   150 DEEMSNLVHYVLKKFRGDQIQLADYALKSAGASVIEAGTSESYKNNKAKLYWHGIGFLNYEMPPD 214

  Fly   836 VAISPNVQPGECWAFQGFPGFLVLKLNSLVYVTGFTLEHIPKSLSPTGRIESAPRNFTVWGLEQE 900
            :.:.|:|.||:||||.|..|.:::||...:..|..|:|||.:.:||:|.|.|||:.|:|:|:.::
Mouse   215 MILQPDVHPGKCWAFPGSQGHILIKLARKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGVMKK 279

  Fly   901 KDQEPVLFGDYQFEDNGASLQYFAVQNLDIKRPYEIVELRIETNHGHPTYTCLYRFRVHGKP 962
            .:.|.:..|.:.:....|::|.|.:|| :.......|:|:|.:|.|||.|||||||||||.|
Mouse   280 CEGEEIFLGQFIYNKMEATIQTFELQN-EASESLLCVKLQILSNWGHPKYTCLYRFRVHGIP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
koiNP_001260738.1 Sad1_UNC 827..962 CDD:285038 53/134 (40%)
Sun3XP_006514658.1 Sad1_UNC 206..340 CDD:369494 53/134 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1569602at2759
OrthoFinder 1 1.000 - - FOG0000864
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12911
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2888
SonicParanoid 1 1.000 - - X471
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.