DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ubl and HUB1

DIOPT Version :10

Sequence 1:NP_610239.1 Gene:ubl / 35592 FlyBaseID:FBgn0022224 Length:73 Species:Drosophila melanogaster
Sequence 2:NP_014430.1 Gene:HUB1 / 855767 SGDID:S000007251 Length:73 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:43/72 - (59%)
Similarity:55/72 - (76%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDYEIHDG 65
            |||:..||||||||||||..:|::||.||:::.|.||:..||||:|..::.||.|.|.|||:||.
Yeast     1 MIEVVVNDRLGKKVRVKCLAEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDQ 65

  Fly    66 MNLELYY 72
            .||||||
Yeast    66 TNLELYY 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ublNP_610239.1 Ubl_UBL5 1..71 CDD:340489 40/69 (58%)
HUB1NP_014430.1 Ubl_UBL5 1..71 CDD:340489 40/69 (58%)

Return to query results.
Submit another query.