DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ubl and AT3G45180

DIOPT Version :10

Sequence 1:NP_610239.1 Gene:ubl / 35592 FlyBaseID:FBgn0022224 Length:73 Species:Drosophila melanogaster
Sequence 2:NP_190104.1 Gene:AT3G45180 / 823654 AraportID:AT3G45180 Length:73 Species:Arabidopsis thaliana


Alignment Length:72 Identity:55/72 - (76%)
Similarity:62/72 - (86%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDYEIHDG 65
            |||:..|||||||||||||.:|||||||||:||||||:.|||.::|||.|:||.|.|.|||||||
plant     1 MIEVVLNDRLGKKVRVKCNEEDTIGDLKKLVAAQTGTRPEKIRIQKWYNIYKDHIPLKDYEIHDG 65

  Fly    66 MNLELYY 72
            |.|||||
plant    66 MGLELYY 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ublNP_610239.1 Ubl_UBL5 1..71 CDD:340489 52/69 (75%)
AT3G45180NP_190104.1 Ubl_UBL5 1..71 CDD:340489 52/69 (75%)

Return to query results.
Submit another query.