DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ubl and UBL5

DIOPT Version :10

Sequence 1:NP_610239.1 Gene:ubl / 35592 FlyBaseID:FBgn0022224 Length:73 Species:Drosophila melanogaster
Sequence 2:NP_077268.1 Gene:UBL5 / 59286 HGNCID:13736 Length:73 Species:Homo sapiens


Alignment Length:73 Identity:63/73 - (86%)
Similarity:66/73 - (90%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDYEIHDG 65
            |||:.||||||||||||||.|||||||||||||||||:..|||||||||||||.:.|.|||||||
Human     1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDG 65

  Fly    66 MNLELYYQ 73
            ||||||||
Human    66 MNLELYYQ 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ublNP_610239.1 Ubl_UBL5 1..71 CDD:340489 59/69 (86%)
UBL5NP_077268.1 Ubl_UBL5 1..71 CDD:340489 59/69 (86%)

Return to query results.
Submit another query.