DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ubl and Gm5955

DIOPT Version :10

Sequence 1:NP_610239.1 Gene:ubl / 35592 FlyBaseID:FBgn0022224 Length:73 Species:Drosophila melanogaster
Sequence 2:XP_006516498.1 Gene:Gm5955 / 102636530 MGIID:3779537 Length:73 Species:Mus musculus


Alignment Length:73 Identity:54/73 - (73%)
Similarity:62/73 - (84%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDYEIHDG 65
            |||:.|||..||||:|:|..|||||||||||||||||:..:|:|||||||:||.:.|.|||||||
Mouse     1 MIEVVCNDCPGKKVQVQCTTDDTIGDLKKLIAAQTGTRWNEIILKKWYTIYKDHVSLGDYEIHDG 65

  Fly    66 MNLELYYQ 73
            |.||||||
Mouse    66 MKLELYYQ 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ublNP_610239.1 Ubl_UBL5 1..71 CDD:340489 50/69 (72%)
Gm5955XP_006516498.1 Ubl_UBL5 1..71 CDD:340489 50/69 (72%)

Return to query results.
Submit another query.