DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ubl and Ubl5c

DIOPT Version :10

Sequence 1:NP_610239.1 Gene:ubl / 35592 FlyBaseID:FBgn0022224 Length:73 Species:Drosophila melanogaster
Sequence 2:XP_003945542.1 Gene:Ubl5c / 100038992 MGIID:3780171 Length:73 Species:Mus musculus


Alignment Length:73 Identity:61/73 - (83%)
Similarity:66/73 - (90%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDYEIHDG 65
            |||:.||||||||||||||.|||||||||||||||||:..||:|||||||:||.:.|.|||||||
Mouse     1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIILKKWYTIYKDHVSLGDYEIHDG 65

  Fly    66 MNLELYYQ 73
            ||||||||
Mouse    66 MNLELYYQ 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ublNP_610239.1 Ubl_UBL5 1..71 CDD:340489 57/69 (83%)
Ubl5cXP_003945542.1 Ubl_UBL5 1..71 CDD:340489 57/69 (83%)

Return to query results.
Submit another query.