DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15237 and anapc15

DIOPT Version :9

Sequence 1:NP_610238.2 Gene:CG15237 / 35591 FlyBaseID:FBgn0033104 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001038915.1 Gene:anapc15 / 751740 ZFINID:ZDB-GENE-060825-43 Length:121 Species:Danio rerio


Alignment Length:110 Identity:31/110 - (28%)
Similarity:52/110 - (47%) Gaps:13/110 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MIPFFPTLKVSVANRYWLDMAPASVNEESQTRRYEDERSNWRESLKTAGTDLQPLGKMLTIPGIE 67
            |...||:|...|....|.|:....| :|::..:.|.:...|.:|:.....:|.|:|:    |..|
Zfish     1 MSALFPSLFPRVTESLWFDLDRPCV-DEAELNQQEQQHQTWLQSIVEKDNNLMPIGR----PIFE 60

  Fly    68 TDDEDANDDSEDTDSHDEEDDETNDRVIPVTQDFYSADDIQMNDE 112
            |.||:..:|.||.:  |.|:|..:|      :|....||:.:.:|
Zfish    61 TFDEEEEEDDEDEE--DSEEDSEDD------EDMQDMDDMNIYNE 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15237NP_610238.2 ANAPC15 6..91 CDD:405840 25/84 (30%)
anapc15NP_001038915.1 ANAPC15 2..61 CDD:291896 15/63 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..121 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50074
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108917
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.