DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15237 and anapc15

DIOPT Version :9

Sequence 1:NP_610238.2 Gene:CG15237 / 35591 FlyBaseID:FBgn0033104 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001107320.1 Gene:anapc15 / 100135123 XenbaseID:XB-GENE-5892495 Length:120 Species:Xenopus tropicalis


Alignment Length:95 Identity:30/95 - (31%)
Similarity:49/95 - (51%) Gaps:6/95 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MIPFFPTLKVSVANRYWLDMAPASVNEESQTRRYEDERSNWRESLKTAGTDLQPLGKMLTIPGIE 67
            |...||:|...|.:..|.::....| :|::.::.|.:...|.:|:......|.|:||..:.|..|
 Frog     1 MSTLFPSLFPQVTDSLWFNLDRPCV-DENELQQQEQQHQAWLQSIAEKDNGLVPIGKPASEPYDE 64

  Fly    68 TDDEDANDDSE-DTDSHDEED----DETND 92
            .::||..||.: :.||.|:||    ||.||
 Frog    65 EEEEDDEDDEDSEEDSEDDEDMQDMDEMND 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15237NP_610238.2 ANAPC15 6..91 CDD:405840 27/89 (30%)
anapc15NP_001107320.1 ANAPC15 4..62 CDD:373676 14/58 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..120 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50074
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.