DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Epac and 1700123K08Rik

DIOPT Version :10

Sequence 1:NP_001097202.2 Gene:Epac / 35588 FlyBaseID:FBgn0085421 Length:1006 Species:Drosophila melanogaster
Sequence 2:NP_083969.1 Gene:1700123K08Rik / 76658 MGIID:1923908 Length:295 Species:Mus musculus


Alignment Length:140 Identity:30/140 - (21%)
Similarity:47/140 - (33%) Gaps:46/140 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 FHC------DAHEDAQTPEDREYIINFKKRVIQFMQKWVMAVRHAAFEEPSVCDFIEDLAAEVEA 600
            |.|      ..|:.|:    |..::.|.:|:|:.:..    :|||:..||.||...:.....:..
Mouse     2 FSCFQASRGSGHKKAK----RGRLVCFWRRLIRPLTH----LRHASHSEPKVCCENDQEPDSMPK 58

  Fly   601 DPDLNEETSIVHNVLTQMARYQEDRNQNAGQKWKLPPNGQPICLFSGNATPSKTVIRPDDDIIFR 665
            .|..|.::   ...:.||..|.....||...          :||                ||...
Mouse    59 HPQFNYKS---REYVQQMIHYIPAAIQNRDH----------LCL----------------DIFVA 94

  Fly   666 VYCADHTYCT 675
            :|   .||.|
Mouse    95 MY---QTYAT 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EpacNP_001097202.2 CAP_ED 36..146 CDD:237999
DEP_Epac 199..330 CDD:239884
CAP_ED 352..463 CDD:237999
RasGEF_N 489..594 CDD:459873 15/57 (26%)
Ubl1_cv_Nsp3_N-like 652..>722 CDD:475130 6/24 (25%)
RasGEF 766..1002 CDD:214539
1700123K08RikNP_083969.1 REM 89..176 CDD:100121 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.