DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Epac and CG7369

DIOPT Version :9

Sequence 1:NP_001097202.2 Gene:Epac / 35588 FlyBaseID:FBgn0085421 Length:1006 Species:Drosophila melanogaster
Sequence 2:NP_649415.2 Gene:CG7369 / 2768961 FlyBaseID:FBgn0037188 Length:680 Species:Drosophila melanogaster


Alignment Length:214 Identity:58/214 - (27%)
Similarity:102/214 - (47%) Gaps:25/214 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   803 KITANLDVFLRRFNEVQYWIVTELVSTPSLSKRVGLVRKFIKLAAYCKEYQNLNAFFAVVMGLSN 867
            |.|.||:.:::.||.:.|...:|:|..|...:||.::..:|:.|..|....|.|:..|::.||:.
  Fly   445 KKTRNLESYVQWFNRLSYLTASEIVKYPKKKQRVRIIEYWIETARECFNIGNFNSLMAIIAGLNL 509

  Fly   868 MAVSRLQQTWEKIPSKFRKIFQEFEALIDPSRNHRAYRVFV-----------GKLQPPLIPFMPL 921
            ..:.||::||.|:.|   ..|...|..:||:.|..:||..:           .:.:..:|||..|
  Fly   510 APIGRLKKTWAKVQS---AKFSVLEHQMDPTSNFNSYRSTLKAAMWRSEGATEERERIIIPFFSL 571

  Fly   922 LLKDMTFAHEGNKTSL-DGLVNFEKMHMMAQTMRTIRFCRSRSLGLE--PPSPKSEGEVRSYISS 983
            .:||:.|.:||....| :..:||||...:|:.:......:..:...|  |       .|.:|:.:
  Fly   572 FVKDLYFLNEGCSNRLPNNHINFEKCSQLAKQVMEFNEWKKVNCPFERLP-------NVIAYLQN 629

  Fly   984 FRVIDNQRVLTAMSQKVEP 1002
            ..|: |:..|:..|.:.||
  Fly   630 SAVL-NENTLSMASFECEP 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EpacNP_001097202.2 Crp 28..>146 CDD:223736
CAP_ED 36..146 CDD:237999
DEP_Epac 199..330 CDD:239884
CAP_ED 352..463 CDD:237999
Crp 373..525 CDD:223736
RasGEF_N 489..594 CDD:279012
UBQ 665..>714 CDD:294102
RasGEF 766..1002 CDD:214539 56/212 (26%)
CG7369NP_649415.2 RasGEF_N 116..261 CDD:279012
RasGEF 388..649 CDD:214539 58/214 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467902
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.