DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Epac and Gm4871

DIOPT Version :9

Sequence 1:NP_001097202.2 Gene:Epac / 35588 FlyBaseID:FBgn0085421 Length:1006 Species:Drosophila melanogaster
Sequence 2:NP_001094933.1 Gene:Gm4871 / 231885 MGIID:3648713 Length:314 Species:Mus musculus


Alignment Length:305 Identity:63/305 - (20%)
Similarity:98/305 - (32%) Gaps:104/305 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 TSEELELVFEELVHIAALSHLSTSIKRELSSIFVFEAHAQAGTILFNQGDEGRSWYILLKGSVDV 400
            |....|.|.:.:.:|.|..|....:.   .|:|:...|....|           |.:|     |:
Mouse    56 TYNSFEFVEQMIAYIPAAVHYHDQLS---ISLFLAVYHRYCST-----------WEVL-----DL 101

  Fly   401 VIHGKGTVATLKTGDDFGKLALIN--------------DAPRAATIVLKENNCHLLRVDKEHFNR 451
            ::....:.......|...|.|:.|              |:|..|  |:::    |:.....|...
Mouse   102 LMKTYPSFQPDCEQDQLTKSAIFNFLAHWLDTFPEHFFDSPNLA--VMRQ----LMDYAGRHMPS 160

  Fly   452 ILRDVEANTL--RLQEHGKDVLVLERVAKQRGQHSAFKYTVMSGTPAKMLEHLLETRL---GQSV 511
            ...|.|:..|  ||:|.....|.||:......:..|          ::|.|: |..||   .:..
Mouse   161 AEFDKESRELLSRLEEQEAKKLKLEKDCAATAEQDA----------SRMQEN-LALRLASVAEPQ 214

  Fly   512 GGMDPFLDDFLLTHIVFMPV------VQL--VDE---LANYFHCDAHEDAQTPEDREYIINFKKR 565
            |.:.|.:|..||...|..|.      |||  .|:   .:.|        .|:|||          
Mouse   215 GDLQPQVDTELLEQSVVEPFVPEPGPVQLPTFDQALPTSTY--------TQSPED---------- 261

  Fly   566 VIQFMQKWVMAVRHAAFEEPSVCDFIEDLAAEVEADPDLNEETSI 610
                     :||..||           |:.|:..||...:|...:
Mouse   262 ---------VAVDEAA-----------DMVADETADEATHEAVDV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EpacNP_001097202.2 Crp 28..>146 CDD:223736
CAP_ED 36..146 CDD:237999
DEP_Epac 199..330 CDD:239884
CAP_ED 352..463 CDD:237999 22/126 (17%)
Crp 373..525 CDD:223736 35/170 (21%)
RasGEF_N 489..594 CDD:279012 25/118 (21%)
UBQ 665..>714 CDD:294102
RasGEF 766..1002 CDD:214539
Gm4871NP_001094933.1 REM 63..176 CDD:100121 26/137 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3629
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.