DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Epac and rgl-1

DIOPT Version :9

Sequence 1:NP_001097202.2 Gene:Epac / 35588 FlyBaseID:FBgn0085421 Length:1006 Species:Drosophila melanogaster
Sequence 2:NP_001123140.1 Gene:rgl-1 / 180611 WormBaseID:WBGene00017891 Length:880 Species:Caenorhabditis elegans


Alignment Length:370 Identity:77/370 - (20%)
Similarity:138/370 - (37%) Gaps:87/370 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   700 GPEDLVLVEVKSNGERSVFKD--NDVSIPTGLSLNGRLFVSVK-DHLDALTQLQEQECPTEGVDI 761
            |...|..:..|:..:|.|||.  ::..:...|...|:....:. |..|....::|:   .:..|:
 Worm   189 GRNKLTELRAKARKQREVFKRIYDEGGMQAALPSLGQYVADMGFDPSDYPNNIKER---VKMFDV 250

  Fly   762 DLEILSTKELAYHITLFEWDLFWAVHEYELLYHT------FGRHHFGKITANLDVFLRRFNEVQY 820
            ..|  :..::|..:|.::..||     .|||.|.      ..|...|:....:...:.:||.|..
 Worm   251 GKE--NCVQIAEQLTFWDAALF-----KELLIHQCQGCVWSKRRTAGERVYTVKATIEQFNSVSQ 308

  Fly   821 WIVTELVSTPSLSK-RVGLVRKFIKLAAYCKEYQNLNAFFAVVMGLSNMAVSRLQQTWEKIP--- 881
            .::|.:|......: |..::.|:|.:|...:..:|.::..||:..|.:..|.||:..|..:|   
 Worm   309 RVMTSIVLPDCRPEYRAKIISKWIDIARELRALKNFSSLKAVLSSLQSEPVHRLKSAWNSVPNRS 373

  Fly   882 -SKFRKIF-------------------QEFEALIDPSR------NHRAYRVFVGKLQ-PPLIPFM 919
             |:||::.                   ||..|...|.|      |.|..:..|...: ...:|::
 Worm   374 ISQFRELSSIYETDEDGDQGNARKILEQEGTAKSSPLRRPQLIQNCRRTKSDVNLAECQGTVPYL 438

  Fly   920 PLLLKDMTFAHEGNKT-SLDGLVNFEKMHMMAQTMRTIRF------------------------- 958
            ...|.|:....|.... :.:.|:||||.....:.:..:|.                         
 Worm   439 GNFLTDLAMVDESTPDYTPENLINFEKRRKEFEVLAKLRLFQSAARAYNIPMDRMFCAWFFFLPC 503

  Fly   959 -----CRSRSLGLEPPSPKSEGEVRSYISSFRVIDNQRVLTAMSQ 998
                 |.:|||.:|.|...|..:    :||.|:  |..:|:..||
 Worm   504 LDENECFNRSLEIEKPPMHSTPD----LSSSRI--NSSMLSNGSQ 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EpacNP_001097202.2 Crp 28..>146 CDD:223736
CAP_ED 36..146 CDD:237999
DEP_Epac 199..330 CDD:239884
CAP_ED 352..463 CDD:237999
Crp 373..525 CDD:223736
RasGEF_N 489..594 CDD:279012
UBQ 665..>714 CDD:294102 3/13 (23%)
RasGEF 766..1002 CDD:214539 63/301 (21%)
rgl-1NP_001123140.1 RasGEFN 84..211 CDD:214571 7/21 (33%)
RasGEF 254..515 CDD:238087 52/265 (20%)
UBQ 752..843 CDD:294102
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.