DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Epac and zbtb22

DIOPT Version :9

Sequence 1:NP_001097202.2 Gene:Epac / 35588 FlyBaseID:FBgn0085421 Length:1006 Species:Drosophila melanogaster
Sequence 2:XP_002938727.2 Gene:zbtb22 / 100488727 XenbaseID:XB-GENE-6458515 Length:436 Species:Xenopus tropicalis


Alignment Length:179 Identity:41/179 - (22%)
Similarity:60/179 - (33%) Gaps:52/179 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 TELVDWLVNLSPIVHTRAQAAGMWQALLEEGVLAHVNKEQPFKDKC--FLYRFR------IDEEG 288
            |.|.|.:||..    |......||..:                |||  .|...|      |.|..
 Frog    94 TMLADEIVNYL----TVGSVLQMWHVV----------------DKCSELLKESRGGNSCGIVEGA 138

  Fly   289 GTAAAGVPQAEDLGAANEHIREALSALF--QRGPDATLRMILRKPSHERTSEELELV---FEELV 348
            |:.....||....|.|:|:...:.|..|  :..|.        :|..||.....|:|   .||.|
 Frog   139 GSTTGPTPQRPHSGRASENQSPSSSNYFSPREAPS--------EPCVERGRRRSEVVSDGAEEAV 195

  Fly   349 ----------HIAAL-SHLSTSIKRELSSIFVFEAHAQAGTILFNQGDE 386
                      .:|:. |:...||..:...::|.:.....|.:|..:|:|
 Frog   196 GEPEQGGGEASVASCSSYRRPSIVPQRHWVYVKKERPHQGLLLTCEGEE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EpacNP_001097202.2 Crp 28..>146 CDD:223736
CAP_ED 36..146 CDD:237999
DEP_Epac 199..330 CDD:239884 24/107 (22%)
CAP_ED 352..463 CDD:237999 8/36 (22%)
Crp 373..525 CDD:223736 4/14 (29%)
RasGEF_N 489..594 CDD:279012
UBQ 665..>714 CDD:294102
RasGEF 766..1002 CDD:214539
zbtb22XP_002938727.2 BTB_POZ_ZBTB22_BING1 12..123 CDD:349519 11/48 (23%)
C2H2 Zn finger 339..358 CDD:275368
zf-H2C2_2 352..374 CDD:372612
zf-C2H2 364..386 CDD:333835
C2H2 Zn finger 366..386 CDD:275368
zf-H2C2_2 378..401 CDD:372612
C2H2 Zn finger 394..418 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.