DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Epac and Gm3404

DIOPT Version :9

Sequence 1:NP_001097202.2 Gene:Epac / 35588 FlyBaseID:FBgn0085421 Length:1006 Species:Drosophila melanogaster
Sequence 2:XP_011239299.1 Gene:Gm3404 / 100041554 MGIID:3781582 Length:311 Species:Mus musculus


Alignment Length:252 Identity:49/252 - (19%)
Similarity:85/252 - (33%) Gaps:95/252 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 FHC------DAHEDAQTPEDREYIINFKKRVIQFMQKWVMAVRHAAFEEPSVCDFIEDLAAEVEA 600
            |.|      ..|:.|::    .:::.|.:|:|:.:..:    |||:..||.||...|.....:..
Mouse     2 FSCFQGSRGSGHKKAKS----GFLVRFWRRLIRPLTHF----RHASHSEPKVCSQNEQEPDSLPK 58

  Fly   601 DPDLNEETSIVHNVLTQMARYQEDRNQNAGQKWKLPPNGQP---IC--LFSGNATPSKTVIRPDD 660
            .|..|.::   ...:.||..|             :|...|.   ||  :|.|             
Mouse    59 RPQFNYDS---QEYVVQMIHY-------------IPAAIQKRDHICITIFLG------------- 94

  Fly   661 DIIFRVYCADHTYCTLRFPMHTTAELIKACAADKLQLNRG------------PEDLVLVEVKSNG 713
              ::|.|.:  |:..|...|.|.|.....|..|: |..|.            |:|.         
Mouse    95 --VYRTYAS--TWEVLDLLMRTYASFRPDCIKDQ-QTKRAIFRFLFGWFKKYPQDF--------- 145

  Fly   714 ERSVFKDNDVSIPTGLSLNGRLFVSVKDHLDALTQLQEQECPTEGVDIDLEILSTKE 770
                ::..|:::             |:..:|.:    ::..|:..||...|:||..|
Mouse   146 ----YESPDLAV-------------VRQFIDYV----KRNVPSSDVDRARELLSVLE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EpacNP_001097202.2 Crp 28..>146 CDD:223736
CAP_ED 36..146 CDD:237999
DEP_Epac 199..330 CDD:239884
CAP_ED 352..463 CDD:237999
Crp 373..525 CDD:223736
RasGEF_N 489..594 CDD:279012 15/57 (26%)
UBQ 665..>714 CDD:294102 13/60 (22%)
RasGEF 766..1002 CDD:214539 3/5 (60%)
Gm3404XP_011239299.1 REM 89..177 CDD:100121 22/135 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3629
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.