DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a2 and CYP4F2

DIOPT Version :9

Sequence 1:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:536 Identity:136/536 - (25%)
Similarity:239/536 - (44%) Gaps:73/536 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIYLLIAISSLLA------YLYHRNFN-------------YWNRRGVPHDAPHPLYGNMVGFRKN 49
            |:.||:..|.|||      |.::.|..             :|..:|:.:.....:          
Human    20 LLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWFWGHQGMVNPTEEGM---------- 74

  Fly    50 RVMHDFFYDYYNKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILIKDFSNFADRGQFHNGRDDP- 113
            ||:......|...::....|.       .|...:....:.::: |...:..|.:.:|.....:| 
Human    75 RVLTQLVATYPQGFKVWMGPI-------SPLLSLCHPDIIRSV-INASAAIAPKDKFFYSFLEPW 131

  Fly   114 LTQHLFNLDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVITE--QVPAAQNGAVLEIK 176
            |...|....|.||...|:.|||.|....:|    ..:|:..|.|.::..  |:.|::..|.|::.
Human   132 LGDGLLLSAGDKWSRHRRMLTPAFHFNILK----PYMKIFNESVNIMHAKWQLLASEGSACLDMF 192

  Fly   177 ELMARFTTDVIGTCAFGIECNTLRTPVSDF--RTMGQKVFTDMRHGKLLTMFVFSFPKLASRLRM 239
            |.::..|.|.:..|.|..:.:....| |::  ..:........||.::|....|.:.......|.
Human   193 EHISLMTLDSLQKCVFSFDSHCQEKP-SEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRF 256

  Fly   240 RMMPEDVHQFFMRLVND---TIA-------LRERENFKRNDFMNLLIELKQKGRVTLDNGEVIEG 294
            |.....||.|...::.:   |:.       |:.:...|..||:::|:..|.      ::|:.:..
Human   257 RRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKD------EDGKKLSD 315

  Fly   295 MDIGELAAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQE-GQLTYESIKA 358
            .||   .|:...|...|.:|::|.:|:.||.||::.:.|:|.|.|:|.:|:::| .::.::.:..
Human   316 EDI---RAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAH 377

  Fly   359 MTYLNQVISETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYPNPETF 423
            :.:|...:.|:|||:..||.:.|....|.|:|  :..||.||...:|.....|.:..::|:||.:
Human   378 LPFLTMCMKESLRLHPPVPVISRHVTQDIVLP--DGRVIPKGIICLISVFGTHHNPAVWPDPEVY 440

  Fly   424 DPERFSPEKVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVCDTTEIPLKYSP 488
            ||.||.||.:..|..:.::||..|||||||..|...:.::.||..:.|||| :.|.||...|   
Human   441 DPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRV-LPDHTEPRRK--- 501

  Fly   489 MSIVLGTVGGIYLRVE 504
            ..:||...||::||||
Human   502 PELVLRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a2NP_523628.1 p450 36..502 CDD:278495 121/481 (25%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 9/36 (25%)
p450 52..515 CDD:365848 123/500 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.