DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a2 and CYP72C1

DIOPT Version :9

Sequence 1:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:251 Identity:53/251 - (21%)
Similarity:89/251 - (35%) Gaps:47/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VPHDAPHPLYGNMVGFRKNRVMHDFFYDYYNKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILIK 95
            |.|..|.||..:.:    .|:| .|.:....|:.|..|.:.|.|    |...::|.:..:.|:.|
plant    67 VAHSLPLPLDADFL----PRMM-PFLHHTVLKHGKKCFTWYGPY----PNVIVMDPETLREIMSK 122

  Fly    96 DFSNFADRGQFHNGRDDPLTQHLF-----NLDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEE 155
            .......:...||        |:|     |.:|.||...|..|.|.|....:|.:.|......:|
plant   123 HELFPKPKIGSHN--------HVFLSGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKE 179

  Fly   156 FVKVITEQVPAAQNGAVLEIKELMARFTTDVIGTCAFGIECNTLRTPVSDFRTMGQKVFTDMRH- 219
            .::. .|::.:|:....|:........|.:::...:||           |....|.|:|...:. 
plant   180 MLEE-WERLASAKGTMELDSWTHCHDLTRNMLARASFG-----------DSYKDGIKIFEIQQEQ 232

  Fly   220 ---GKLLTMFVF----SFPKLASRLRMRMMPEDVHQFFMRLVNDTIALRERENFKR 268
               |.|....|:    .|.......|:|....|:...|..::.     .:.|..||
plant   233 IDLGLLAIRAVYIPGSKFLPTKFNRRLRETERDMRAMFKAMIE-----TKEEEIKR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a2NP_523628.1 p450 36..502 CDD:278495 51/246 (21%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.